CAZyme Information: ATCC64974_71480-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_71480-t41_1-p1
• CAZy Family: GH63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
871	OGUI01000011.1|CGC3	96076.65	5.5192

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000011.1:20531-23449(-)

Full Sequence      

MAIIPPELDHFYASNMDLEVILRSLTLPEKVTLLAGASTWRTAPVPRVNIPHLKLSDGPS
GARGEIFGDSVPAAFFPSGTSLGATWDEDLLGELGQILAEECKSKSASVILGPTMCIHRH
PLGGRNFESYSEDPYLTGRLATATIRGIQSRGIGATAKHYVANDQETDRFHYNAVIPTRA
LREVYLRPFQMVVRDANPWCLMTAYNRVNGAHCDENVELLTDILRKEWGWEGVAMSDWGG
AHDAAQSLVAGLDLEMPGPPVRRTWEIVQQYLADSKITEADVDRSVHRILRLLKRTKRFE
NDSEHPETTLRNSNNTARLLHAAQSGIVLLKNEAGCLPLWPSEGLERVGIFGPNSARVVA
GGGGSSYIKAPYWTNVDDSLTARFQDTTTEIVRNVGAKVNRYLPAITLAATRNPDTGGQG
AAIDWFSGHDLSGQPTETIHTDDLYYINFGNTPQTIATETGFSFRLRTTIVPLTTGTHRL
SLASIGPSKLYISGQLMAHQDGNFEKRGTLFFTYGSHEAIFTLDMVAGQEYHVEIEYWSH
DRQLSAELLPRMDPMEDKFQGVRLGYEEANRRDLPSEAAKQARDCEAAVVVVGRDREWET
EGQDVPMFALPGEQVRLIEEVAAVCARTIVVIQSGTPVQLEPWIENVKGVVCAWYQGQEL
GNATASVVCGEFNPSGRLPMTWPRRLEECPAFSSFRVEAHEIQYAEGIYVGGRWWDLLGT
QPMYPLGYGLSYNTFALRIVHPEQLAMVTGPQPVQVIVEVTHRGDGAVGLPGRETVIAWC
EVVDSGNGRLARPPKQVSAFAKSPLLAPGETCTVSLSITAYELGVYDPERQKWVLDKGAQ
FRILVGADAAHTQKAGTIHVPETITWVHRLD

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	257	3.5e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.40e-64	46	395	56	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.60e-47	561	711	67	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	2.55e-46	76	855	120	760	beta-glucosidase BglX.
395747	Glyco_hydro_3	4.51e-39	61	292	76	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.04e-35	25	747	60	649	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07145.1|GH3	0.0	17	867	11	855
BCR94550.1|GH3	0.0	17	867	11	855
AEO53892.1|GH3	7.76e-204	22	867	60	883
AEO66128.1|GH3	2.47e-203	22	867	63	887
EGX50909.1|GH3	2.31e-201	18	866	20	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.25e-153	14	866	2	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.24e-149	14	866	2	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.76e-110	16	864	3	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.35e-98	22	849	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.28e-96	21	862	7	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	2.22e-170	14	866	9	835	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q5BFG8|BGLB_EMENI	2.72e-170	17	846	10	824	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	7.60e-158	21	861	5	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.17e-155	15	867	3	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.99e-154	15	867	3	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_71480-t41_1-p1.