CAZyme Information: ATCC64974_70160-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_70160-t41_1-p1
• CAZy Family: GT76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649	OGUI01000010.1|CGC3	65597.68	4.5140

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000010.1:2332668-2335180(+)

Full Sequence      

MGSYTFTWPYNANEVFVTGTFDDWGKTVKLDRVGDVFEKEVPLPVTDEKVHYKFVVDGIW
TTDNRAPEEDDGSSNINNVLYPDQILKDSTTPLLNGTAAMAGVTPGSTTAALAAGVPKES
SSKHGQNGYYPTISSAAPGSTTAALGQDVPLEQRANVPGSFPVTPASEADKFSVNPIPAS
SGAGNPIKLNPGEKVPDPSTFNTNTISSTARTDRAGYEQGTSGGFPGSPAYDASAFAIPP
VSKNMIPESSLPMGESQGATEPTYTIQSAAPTSTTAGLAAAVPLESQRQTSSGAPTRDVP
DVVRQSMSEAHRDPEAATNKEAVDEKKEMEEELRRKVPVDNSTGAPAPTTVAGLGTSSGL
GFTAGAAPSTNLGPSTGLDVATGMGTTTGLDSVSGPTAAQSFQKETTSGLPAHDVPDVVK
QSISEAHKDPEAAGVEEAVGEKREVEEELQQKVPVSNQSGTPAPVITAATSETAPGSGAG
PASERAPRATGGGPASAQISPRATTPTDGPTVTTGVATSKAPEESGPGASGREETTEIPT
KPAAGATGASATKTVDSGVESGIAPEDTTSAPTAGATGASATKTADPTETSGAPTSGASK
PAESAPTNNAAATSKPATNNAAGAATNGKEEKKKKKGFFSRLKEKLKSV

Enzyme Prediction     

No EC number prediction in ATCC64974_70160-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199889	E_set_AMPKbeta_like_N	1.33e-24	3	80	1	78	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
406865	AMPK1_CBM	3.31e-23	5	80	4	77	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199892	E_set_Isoamylase_like_N	7.93e-08	5	78	4	81	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.
235906	PRK07003	6.77e-06	458	611	394	552	DNA polymerase III subunit gamma/tau.
223021	PHA03247	7.28e-05	165	611	2483	2899	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46804.1|CBM48	8.82e-318	1	649	1	648
BCS15067.1|CBM48	8.52e-290	1	649	1	650
BCS03439.1|CBM48	8.52e-290	1	649	1	650
QRD82410.1|CBM48	1.06e-141	1	350	1	351
QMW27962.1|CBM48	2.17e-136	9	350	13	355

PDB Hits     

ATCC64974_70160-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZT54|CRP1_YEAS7	3.15e-07	1	69	6	77	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=CRP1 PE=3 SV=1
sp|B3LSR0|CRP1_YEAS1	3.15e-07	1	69	6	77	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=CRP1 PE=3 SV=1
sp|C7GJZ2|CRP1_YEAS2	3.15e-07	1	69	6	77	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain JAY291) OX=574961 GN=CRP1 PE=3 SV=1
sp|C8Z9U3|CRP1_YEAS8	3.15e-07	1	69	6	77	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=CRP1 PE=3 SV=1
sp|E7KDM2|CRP1_YEASA	3.15e-07	1	69	6	77	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain AWRI796) OX=764097 GN=CRP1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_70160-t41_1-p1.