CAZyme Information: ATCC64974_68720-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_68720-t41_1-p1
• CAZy Family: GH53
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		65025.12	6.3493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000010.1:1900549-1902504(-)

Full Sequence      

MLSCWQLLQLLLATSLPAAAINLTGYEYIVVGSGAGGGPLAARLALAGHSTLLLEAGTEQ
AHNFNTSVPGYAALAAADDHLSWNFFIRHYANDTQQARDPKTVYTTPTGEQYVGLHPPPG
SIMKGILYTRASTLGGCTAHNALVAIYPHRSDWTYIANLTNDPSWLPDPMREYYVRLENN
HYLPPDIPGHGYTGWLSTEHAPINLVLQDPQLLSLLLGAVFTQPRNILSNLISLLLGDVN
ANFPSRDSKPAYYQMPIATSSNVRNGAADFLRAVHSATNPDDTQKYPLTIRTNCHVTRVL
FDTTSTSQAPKATGVAFLDGPYLYRASPLSSQDTPRTPGTATASREIILSAGVFNTPQIL
QLSGIGPADLLKKHHIPVLINLPGVGANLQDHYETSVVVEAPFPFRVLDGCTFNYTSDPC
LLRWLNPNGHKDRGIYSSAGFTSTLLHHTPNTSTTPNQNNDNDDYNTMVYGGLVNFRGYF
PGFEVNITATHHSFTWAIIQAHPSNRAGTVNISSADPLDPPHILFNSFSDPNSEKDLFGI
GSGDERDEGAVVDGKFRVRGLRALRVVDASVLPRAQGTFPVLGVYMLAEKAVGDILAEE

Enzyme Prediction     

No EC number prediction in ATCC64974_68720-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	597	1.3e-65	0.5016181229773463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.76e-48	26	598	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.51e-41	26	596	6	532	choline dehydrogenase; Validated
215420	PLN02785	7.46e-18	26	406	56	341	Protein HOTHEAD
366272	GMC_oxred_N	1.53e-14	130	394	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.58e-11	508	591	5	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15218.1|AA3	0.0	1	599	1	656
BCS03593.1|AA3	0.0	1	599	1	634
QMW33146.1|AA3	8.42e-222	6	598	5	644
QRD84722.1|AA3	8.42e-222	6	598	5	644
QMW45179.1|AA3	8.42e-222	6	598	5	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.66e-22	26	591	41	593	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	7.28e-21	26	404	14	322	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.71e-20	26	404	14	322	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.71e-20	26	404	14	322	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
5OC1_A	2.59e-15	26	599	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2K8U4|BETA_YERPB	7.44e-26	26	574	3	510	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	7.44e-26	26	574	3	510	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	2.37e-25	26	574	3	510	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|A7FKL6|BETA_YERP3	2.37e-25	26	574	3	510	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	4.24e-25	26	574	3	510	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000614	0.999360	CS pos: 20-21. Pr: 0.9597

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_68720-t41_1-p1.