CAZyme Information: ATCC64974_66310-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_66310-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60164.50	6.5034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000010.1:1084570-1086301(+)

Full Sequence      

MATTNEFPASDVNSYDYVIVGGGTAGCVIASRLAEYLPNKRILIIEGGPSDFMDDRVLKL
KDWLNLLGGELDYDYPTVEQPMGNSYIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWEQA
GCTGWSFDTFTRVLDNLRNTVQPVHNRHRNQLCKDWVQACSSAMNIPVIEDFNKEIRSKG
ELTEGVGFFSVSYNPDDGRRSSASVAYIHPILRGEEKRPNLTILTNAWVSRVNVDGDSVT
GVDVTLQSGVKHTLRAKKETILCAGAVDTPRLMMLSGLGPREQLSGLGIPVVKDIPGVGE
NLLDHPESIIIWELNRPVPPNQTTMDSDAGIFLRRELPNANGFDGRAADIMMHCYQIPFC
LNTERLGYDTPVDAFCMTPNIPRPRSRGRIYLTSADPSVKPALDFRYFTDPEGYDAATIV
AGLKAAREIAKQSPFKDWIKREVAPGPNVQTDEELSEYGRRVAHTVYHPAGTTKMGNLTR
DPMAVVDPKLKVRGLKNVRIADAGVFPEMPTINPMLTVLAIGERAAELIAEEAGWKREQP
RL

Enzyme Prediction     

No EC number prediction in ATCC64974_66310-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	531	1.4e-139	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.18e-124	13	534	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.94e-118	13	529	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.69e-47	384	525	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.20e-31	13	522	54	569	Protein HOTHEAD
366272	GMC_oxred_N	3.47e-30	15	307	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47101.1|AA3_2	0.0	1	542	1	542
BCS03844.1|AA3_2	0.0	1	542	90	631
BCS15458.1|AA3_2	0.0	1	542	1	542
EAA64559.1|AA3_2	0.0	1	542	1	542
BCS21375.1|AA3_2	0.0	1	542	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.44e-129	15	529	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.04e-129	15	529	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	5.75e-129	15	529	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	7.90e-59	15	533	84	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.08e-58	15	533	8	564	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	7.42e-129	15	529	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	4.47e-80	14	530	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.63e-76	15	532	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	5.31e-76	10	529	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	3.33e-74	15	529	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_66310-t41_1-p1.