CAZyme Information: ATCC64974_63240-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_63240-t41_1-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		55744.73	4.5289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000010.1:47232-48994(+)

Full Sequence      

MVKLAYILGAVTVFLTSGNAADVSPTSSVAASTTPSAADSLSSLGLSLPAGNVLVGNVGY
TCNLLRRTFPQNETFTASSPYYEPLIDEAWSGNCRLNASCIVTPKSAQEVSLVIQVLSIL
DTKFSIRSGGHSSSPGFSSIGSNGVLVALERLNTLSISADRKTLTVGPGNRWEAVYQYLE
QYNLTVLGGREPVVGVGGFVLGGGLSLFYNTNGLAIDTVTRFQVVTPNGTIVNATPTEHA
DLYKGLKGGLNNFGIIVEYDLTTNTGIDVWFEVKNYTRAETPALLAAYATYLQNADVRSN
VEIQANPAYTVVLYGYLDHVSAPSAFNAFSTVPSVSTVYPPTNASLNEVLLEIGTAGVTG
SSWTYTVSFSFKVTNPDFLQESYKTYLEAAASLLPSGVLLEYVPQGIIPNLVTKGQAQNG
GNLLGLEATPQVWGEIFAQFPATVSQSTVASAVNDLLAKITSSAESQGVHLPYIFANDAG
PDQQVLRGYGEDNLKYIATVAERYDPKGVMQKLQNDAYFVSKEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	90	327	1e-47	0.517467248908297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	8.18e-19	98	510	32	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	9.18e-18	98	235	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
215242	PLN02441	8.31e-05	90	256	57	231	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI58761.1|AA7|1.1.3.-	1.85e-17	99	306	38	251
AAS79317.1|AA7|1.1.3.-	4.93e-17	99	306	63	276
RDX44700.1|AA7|1.1.3.-	3.82e-16	99	379	70	347
CAI94231.1|AA7|1.1.3.-	6.72e-16	99	352	60	323
CEI70304.1|AA7	1.49e-15	53	263	9	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HSU_A	7.32e-19	99	306	44	257	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	1.73e-18	99	306	44	257	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6FYD_A	6.09e-17	87	295	31	240	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
3RJ8_A	6.34e-17	99	352	38	301	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6FYE_A	8.11e-17	87	295	31	240	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G3Y424|YANF_ASPNA	0.0	1	524	71	580	FAD-dependent monooxygenase yanF OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=yanF PE=1 SV=1
sp|A0A2P1DP98|MACF_PENTR	2.56e-255	1	524	1	519	FAD-dependent monooxygenase macF OS=Penicillium terrestre OX=374132 GN=macF PE=3 SV=1
sp|A0A0U5GQ05|DRTC_ASPCI	2.47e-57	58	522	41	515	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|D7UQ40|SOL5_ALTSO	1.54e-52	56	513	53	507	Bifunctional solanapyrone synthase OS=Alternaria solani OX=48100 GN=sol5 PE=1 SV=1
sp|M2T7Z1|TPCD_COCH5	1.57e-49	99	513	80	510	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000304	0.999675	CS pos: 20-21. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_63240-t41_1-p1.