CAZyme Information: ATCC64974_61820-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_61820-t41_1-p1
• CAZy Family: PL4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	OGUI01000008.1|CGC10	57809.26	9.0084

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000008.1:938535-940206(+)

Full Sequence      

MSYTYRYGSADNSSSRSSSTPCILFLTNSEREHSGVTLAVVHEFLIGNSPYKVHIGSFGP
LKRHIAELNYYAAASGSPCATEAVFEEIPGMSMKHVRMRDGQFDDIPQVGFFAALKNYRK
DLALGLLPWTGDDYVEIFDAVVELVKTLGPVLIVVDPLFAPAVDVCRYLRWRHVLLGAGG
VKDHVVKWKLSDLMKYPMICSGFKMPMSLWDKLRNIFLGFRFKHELEKCASLKGVNDARE
ARGIEGPVPFLSHEAKKSSRIILPSWPETDFPLVVPEHMTLCGPILRRYRPMVKEDPELA
HWLSKRPTVLVLMDSRFSYDGKQQIEIAKAIQKLLEQELNMQVLWKLKHVEDPAVTREIV
KLLGVYIHGKRMRIAKRFVFEIMSLLMSGHVTCLVHHGGANVFHEAVRAEIPQIVLPVWF
DAYDYAARVEYLGIGIWGSRRSAPKVSGEELGDALLRVVTASDESHAMRMRAMQVAGQLP
FKDGRVVAYERLLEVLSQPWEPPHTRSRSRG

Enzyme Prediction     

No EC number prediction in ATCC64974_61820-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.70e-21	103	474	54	386	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.18e-08	395	480	305	386	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	2.87e-05	272	475	230	428	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47643.1|GT1	0.0	1	511	1	511
BCS08887.1|GT1	0.0	1	508	1	510
BCR96374.1|GT1	0.0	1	508	1	510
BCS26405.1|GT1	1.60e-126	20	496	3	483
BCR88350.1|GT1	5.69e-118	21	505	2	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IIR_A	3.18e-11	381	498	292	400	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	2.23e-10	379	498	273	383	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.59e-07	391	498	303	401	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
5XVM_A	2.15e-06	391	484	343	427	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.20e-06	391	484	363	447	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.41e-72	21	457	6	436	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	8.74e-64	21	484	6	493	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|P96559|GTFB_AMYOR	1.59e-10	381	498	292	400	Vancomycin aglycone glucosyltransferase OS=Amycolatopsis orientalis OX=31958 GN=gtfB PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	9.95e-10	377	469	446	536	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	3.73e-08	377	459	447	527	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_61820-t41_1-p1.