CAZyme Information: ATCC64974_6030-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_6030-t41_1-p1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35877.19	6.9064

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:1825080-1826045(+)

Full Sequence      

MAVVFGRPRQLAVAVIFSFIIFAIFQFSYTDDFSLTGHLSDSIQIVDACSPDALEAINNA
RPTLDPAIPNIVHQLWKTTDIREYSPTITASRESWRAMLEPFNYTVKLWTDDDVLELIKA
DYDWLLSTYEGYPHDIQRADIARLLIVHSEGGIYSDLDVNPKSAQHIQCLQRLSLQAIFS
PTAGTLGLSNHFFMAMPGSPFLQWALYEAKRRSSRLVSRGIILPYLQVFWSTGPIMVTAA
FRQYAWLYNTPRLDIGLLDNGFGGLVVRHAAGRSWQGVDGRALNYLADHAGIGLILGAVA
CFLTVAGLVFVVRGYNGRFPR

Enzyme Prediction     

No EC number prediction in ATCC64974_6030-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	90	162	3.8e-16	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.85e-22	64	244	78	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.39e-09	91	161	7	79	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98326.1|GT32	3.90e-200	1	321	1	321
BCS10670.1|GT32	7.52e-177	1	321	1	291
CAK45844.1|GT32	9.79e-157	26	261	27	263
UNI15388.1|GT32	1.04e-124	31	313	13	301
CAP80286.1|GT32	2.52e-117	1	293	54	348

PDB Hits     

ATCC64974_6030-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	2.45e-27	68	302	64	288	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.86e-22	67	315	56	290	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	1.22e-21	46	244	31	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.36e-21	39	244	54	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	3.63e-20	47	307	37	291	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999238	0.000787

TMHMM  Annotations     

Start	End
10	29
220	242
290	312