CAZyme Information: ATCC64974_52820-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_52820-t41_1-p1
• CAZy Family: GH29
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	OGUI01000007.1|CGC1	47809.17	4.7868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000007.1:3143647-3144969(+)

Full Sequence      

MSVFKASFLFLLSSSLVHGVPHSSRASRSQQCVVPSKYQASNGTADDSAAVSQAFAQCAT
DSVIIFEEGVNYNIFQPITATNLSNVEIRMHGNLHLPQNITAVQNIVSDGTSTWFTLEGP
KVDWIGPEDVNNGWIDSYGQPWWDANPAGSSGIDNRPHLMSFKSSQATMKYFRSRKPIAW
NVKLHGQDITVSHAIIDATSTGSFPFNTDGFDVEGTNIQITDSIMYNGDDAIAVGADSHD
ILFTRNTIGYQTHGMSIGSLGKDPTDFANISNIRFDDVTVVDGLYAARFKSWSGGTGLVK
NVTWNNIRVFNVTFPIFVTQSYSDQGASRSGTVNASSAVMMEDFTWSDFAGSINTYQPGD
GSCVSDPCWYNVGLPNLKHTEALIIECHTAQSCKNFVTDNIQLYPQVLEPASVICMNATA
ALNPDLGFTCKNGTYSPLSN

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	56	420	1.7e-49	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	6.73e-31	124	374	47	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	2.51e-25	42	417	57	388	polygalacturonase
177865	PLN02218	2.30e-21	17	352	51	381	polygalacturonase ADPG
178580	PLN03003	8.61e-20	42	368	34	347	Probable polygalacturonase At3g15720
215426	PLN02793	1.05e-19	189	433	211	428	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD14402.1|GH28	0.0	1	440	1	440
ABD61565.1|GH28|3.2.1.67	0.0	1	440	1	440
BCS06604.1|GH28	0.0	1	439	1	439
BCR93993.1|GH28	0.0	1	439	1	439
CAK44512.1|GH28|3.2.1.67	9.18e-286	1	440	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CZF_A	1.45e-17	79	396	46	356	Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]
1HG8_A	8.27e-16	135	363	81	321	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1K5C_A	7.80e-15	115	324	61	264	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27UB0|PGXC_ASPNG	0.0	1	440	1	440	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1
sp|A2QEW2|PGXC_ASPNC	0.0	1	440	1	440	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2
sp|Q2UQ40|PGXC_ASPOR	3.23e-249	1	436	1	435	Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxC PE=3 SV=1
sp|B8MZZ6|PGXC_ASPFN	3.23e-249	1	436	1	435	Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxC PE=3 SV=1
sp|A1D7I1|PGXC_NEOFI	2.08e-248	16	437	18	439	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999701	CS pos: 19-20. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_52820-t41_1-p1.