CAZyme Information: ATCC64974_49900-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_49900-t41_1-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		48258.41	3.8885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000007.1:2170723-2172237(+)

Full Sequence      

MHQRALLFSALLTAVRAQQAGTLTEEVHPSLTWQKCTSEGSCTEQSGSVVIDSNWRWTHS
VNDSTNCYTGNTWDATLCPDDETCAANCALDGADYESTYGVTTDGDSLTLKFVTGSNVGS
RLYLMDTSDEGYQTFNLLDAEFTFDVDVSNLPCGLNGALYFTAMDADGGVSKYPANKAGA
KYGTGYCDSQCPRDLKFIDGQANVDGWEPSSNNDNTGIGNHGSCCPEMDIWEANKISTAL
TPHPCDSSEQTMCEGNDCGGTYSDDRYGGTCDPDGCDFNPYRMGNDSFYGPGKTIDTGSK
MTVVTQFITDGSGSLSEIKRYYVQNGNVIANADSNISGVTGNSITTDFCTAQKKAFGDED
IFAEHNGLAGISDAMSSMVLILSLWDDYYASMEWLDSDYPENATATDPGVARGTCDSESG
VPATVEGAHPDSSVTFSNIKFGPINSTFSASA

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	19	448	8.9e-193	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	26	442	2	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	20	447	1	434	Glycosyl hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF04491.1|GH7|3.2.1.176	0.0	1	452	1	452
AAR79028.1|GH7|3.2.1.176	0.0	1	452	1	452
AAP66263.1|GH7|3.2.1.176	0.0	1	452	1	452
ACT65727.1|GH7	0.0	1	452	1	452
CAK39699.1|GH7|3.2.1.176	0.0	1	452	1	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Q9H_A	7.83e-247	19	451	2	437	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4V1Z_A	1.24e-232	19	450	2	439	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
4ZZT_A	9.26e-218	19	449	2	436	Geotrichum candidum Cel7A structure complex with thio-linked cellotriose at 1.56A [Geotrichum candidum],4ZZU_A Geotrichum candidum Cel7A structure complex with thio-linked cellotetraose at 1.4A [Geotrichum candidum],4ZZV_A Geotrichum candidum Cel7A apo structure at 1.4A [Geotrichum candidum],4ZZW_A Geotrichum candidum Cel7A structure complex with cellobiose at 1.5A [Geotrichum candidum],5AMP_A Geotrichum candidum Cel7A apo structure at 2.1A [Geotrichum candidum]
4ZZP_A	4.70e-211	19	448	2	436	Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum],4ZZP_B Dictyostelium purpureum cellobiohydrolase Cel7A apo structure [Dictyostelium purpureum]
4XEB_A	3.99e-209	19	449	2	434	The structure of P. funicolosum Cel7A [Talaromyces funiculosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QPG2|CBHA_ASPNC	0.0	1	452	1	452	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhA PE=3 SV=1
sp|Q9UVS9|CBHA_ASPNG	0.0	1	452	1	452	1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger OX=5061 GN=cbhA PE=2 SV=1
sp|Q0CRF7|CBHA_ASPTN	1.85e-269	1	452	1	451	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhA PE=3 SV=1
sp|Q2UBM3|CBHA_ASPOR	5.74e-262	1	452	1	455	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cbhA PE=3 SV=1
sp|B8N7G5|CBHA_ASPFN	5.74e-262	1	452	1	455	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=cbhA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999738	CS pos: 17-18. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_49900-t41_1-p1.