CAZyme Information: ATCC64974_48640-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_48640-t41_1-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		67344.55	4.9568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000007.1:1717406-1719340(+)

Full Sequence      

MQSCVKHYVGYEQATGQNPTTNADGVVIEGYSSNIDDRTMHEIYSWPFAKAVRAGVSSVM
CAYSRINGSYACENPKTLDGILKEELGFPGYVMSDWGATMSGVQAIESGLDMTMPGALMG
SGRTTWGFSLFGGNLTQAVENGTLSMSRVNDMVLRVMTPYFDLNQDDKHWPLIDPSSQEL
GDFSDSMANYSWPVGGEAHRDVRGNNAAFIRKLGAESVTLLKNKNSALPIKEIPRYIGVF
GNDAADKSAGLASSPDSEAIGTFATGGGSGSGRLTYIVSPLEAIKSWAKGRSNSLVQYLT
DNELTPGLLHPTNVGFGDSIYPIPEVCFVFLRYYVSEGPDHSDFDLDNNGSSVVNSVASI
CNNTIVVTHSGNVNLMDWADHPNVTAIMMAYMPGQESGNAILDVITGKVNPSGKLPFTVA
YNASDYNTASVNFTAMNITNSNGRQINFTEGQFIDYRHFDKAGITPRYEFGYGLSYTTFS
IQELSLEPTNKGNVASLPDNSRAIQPGGHPDLYEILITVESNVTNTGALAGATVPQLYLA
FPQDTTPPGTPVKVLRGFDKIYLEAGCSRTVTFELTRKDVSFWNVVKQQWEIPAGTFEAM
VGLSSRKISVKKQFDVLRRR

Enzyme Prediction     

EC	3.2.1.-:5	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	115	9e-33	0.5046296296296297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	4.76e-52	218	456	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	5.18e-51	1	617	204	765	beta-glucosidase BglX.
405066	Fn3-like	1.40e-28	534	605	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
178629	PLN03080	5.97e-27	1	602	210	769	Probable beta-xylosidase; Provisional
224389	BglX	1.43e-26	1	250	161	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39579.1|GH3	0.0	1	620	160	779
UJO22853.1|GH3	1.36e-202	1	614	199	811
QGI97665.1|GH3	1.70e-202	1	618	203	810
QGI66779.1|GH3	1.70e-202	1	618	203	810
QGI84016.1|GH3	1.70e-202	1	618	203	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBS_A	2.50e-130	6	608	207	795	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
6KJ0_A	6.97e-130	6	608	207	795	Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes],6KJ0_B Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes]
6JXG_A	7.80e-126	1	611	150	707	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
3ZYZ_A	1.13e-122	1	616	153	712	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]
4I8D_A	1.16e-122	1	616	154	713	Chain A, Beta-D-glucoside glucohydrolase [Trichoderma reesei],4I8D_B Chain B, Beta-D-glucoside glucohydrolase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U325|BGLG_ASPOR	3.88e-202	1	609	206	805	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|B8NMR5|BGLG_ASPFN	3.88e-202	1	609	206	805	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q5B0F4|BGLG_EMENI	7.05e-201	1	608	207	808	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|Q0CUC1|BGLG_ASPTN	9.63e-198	1	608	206	804	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|A1DC16|BGLG_NEOFI	1.36e-197	1	608	206	804	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_48640-t41_1-p1.