CAZyme Information: ATCC64974_46690-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_46690-t41_1-p1
• CAZy Family: GH20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	OGUI01000007.1|CGC5	40972.30	5.1013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000007.1:1133155-1134297(+)

Full Sequence      

MLTFRKSLLAAALLITFIVYLRSSHTASSLPSPDTSSAGHLYNQDYDGHADNERKGGTRD
TVQQLPLTPPPSAPLRDRLRYHFPYDLEAKFPAFIWQTWKYAPSSMFFSESLRDPESSWS
ELHPGFVHEVVPDDTQRHLIKYLYGAVPDVFEAYDAMPLPVLKADFFRYLILLARGGIYS
DIDTTALKPASDWLPAELDLATVGAVVGIEADPDRPDWHDWYARRIQFCQWTIQAKPGHP
IMRDIVSYITEETLRMKKAGILKTGKMDKTVMEYTGPGAWTDAVFRYFNDPEYFNIEPGS
TLNITYEDFTGQEGYKKVGDVVVLPITSFSPGVHQMGAGDVDDPMAFVKHHFEGTWKDDS
SL

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	196	1.7e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.55e-45	75	359	66	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.44e-18	118	197	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39413.1|GT32	2.48e-276	1	362	1	362
BCS07268.1|GT32	3.24e-272	1	362	1	362
BCR94678.1|GT32	3.24e-272	1	362	1	362
CBV36935.1|GT32	1.43e-208	1	362	1	359
ACQ06321.1|GT32	9.93e-205	1	356	56	408

PDB Hits     

ATCC64974_46690-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.15e-97	70	359	78	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	8.21e-83	81	359	132	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.99e-74	22	357	54	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.74e-70	75	360	80	473	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5UQW4|YL373_MIMIV	3.85e-06	92	194	3	101	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.162080	0.837878	CS pos: 29-30. Pr: 0.4980

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_46690-t41_1-p1.