CAZyme Information: ATCC64974_43810-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_43810-t41_1-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		26890.26	4.2308

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000007.1:204122-204976(-)

Full Sequence      

MRSILFILFSLFAGLAAGQLIGPVGPTTQLEDKDIECNILDYGGVADNETDVATSIETTF
TECVLNNPKSRLVIPEGDYLIKRSVVLSNGTNWAFQLDGLITAAYGGNWTVDRELILQGF
AGEQIINSTINGEGDGKFLLDVLVIVNAVDFEFYSSNGLGAFQGQGYIYRNLANTDRPRL
VRLISPTNASVHDLILVDSPKFHIVFDFAVNLEAYHLTIRGANLGSYDGIDAIGTNYYIH
DNEASR

Enzyme Prediction     

No EC number prediction in ATCC64974_43810-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227721	Pgu1	7.71e-06	38	231	84	291	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07562.1|GH28	2.52e-162	10	246	10	246
BCR94991.1|GH28	2.52e-162	10	246	10	246
UDD55912.1|GH28	9.71e-139	7	246	4	243
ABD67155.1|GH28	1.49e-138	1	246	1	211
CAK96548.1|GH28	3.93e-138	1	244	1	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	9.59e-37	19	246	1	195	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U7A4|RHGE_ASPOR	2.29e-43	18	241	21	214	Probable rhamnogalacturonase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgE PE=3 SV=1
sp|B8NKB9|RHGE_ASPFN	8.54e-43	18	241	21	214	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q5ARE6|RHGA_EMENI	3.02e-42	15	246	14	213	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|Q1ZZM3|RHGE_ASPNG	6.48e-42	19	241	23	215	Probable rhamnogalacturonase E OS=Aspergillus niger OX=5061 GN=rhgE PE=3 SV=1
sp|P87160|RHGA_ASPNG	1.23e-40	15	246	15	214	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999724	CS pos: 18-19. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_43810-t41_1-p1.