CAZyme Information: ATCC64974_42760-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_42760-t41_1-p1
• CAZy Family: GT69
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	OGUI01000006.1|CGC10	47215.08	8.4514

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000006.1:1161077-1162494(+)

Full Sequence      

MIWRYLLRRPMLGTLCILVLFTWLLQQPDTSVKEIYLLQHRYPLLFERVHTNTRSGGAWY
IPPTWTNKTSQPPENIVDAAEQVLRLVQETPQRQIPHSLIPLIIHQTWKDTRVDTWPHVL
QQSTEKWLRTGDGQMAYFLWDDDGIRQFIRRFEPEREKQFYALPSHVEQSDVFRILVSKW
IGGVYADIDTEPLQSPASWITAADIAPWQDHETGRVYNFTGPVRAIVGLEADCPPDSDAY
WRMGYLLPVQLTQWAFAWAPGHPILQIFLDRLFTEVRGVSDQRTPAPQSQSSDLGALDPI
TLTGPVAFTHAVQSWLKAIVGLRWNALSSLQDGGKSKLVDDVLILPITGFSPGRGKYGNM
GSKPITDPSARLFHRAQGSWREFNLRVEYGKFCRTVFGRCRTWSKVPQGLLL

Enzyme Prediction     

No EC number prediction in ATCC64974_42760-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.58e-18	97	273	79	244	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.99e-10	117	200	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44893.1|GT32	1.09e-255	1	335	1	335
BCR93027.1|GT32	5.17e-188	7	407	6	408
BCS05686.1|GT32	5.17e-188	7	407	6	408
CAK38082.1|GT32	5.17e-188	38	407	37	408
ADK37855.1|GT32	5.20e-174	7	385	6	385

PDB Hits     

ATCC64974_42760-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.38e-27	88	382	129	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.45e-19	101	382	100	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.06e-15	97	351	127	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.01e-13	100	382	96	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.65e-08	98	200	55	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000008

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_42760-t41_1-p1.