CAZyme Information: ATCC64974_42750-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_42750-t41_1-p1
• CAZy Family: GH172
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		39039.00	8.9413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000006.1:1158927-1160008(-)

Full Sequence      

MAHARIRLVLAALLLFILTSLLAPFFCNLYLLLRLPFVWKTSSANAIITQQHDGFDLTFS
DYNSTYSVADTSLSVPVPARLHHVQLGAQSPRPEWQAARDECLKQHPDWETFLWTDENAS
RFVQNYYPHFLPTWENYPHLVQRVDALRYMVLHKYGGAVLDYDLACKRSLEPLRRFEFVA
PAANPVGISVGMMLAAPNNSYVNDLVRNLPNFNRRWSFLPYITVMFSTGCHYASTIYTMQ
RQTSTLRVLTGPPENPRMHMLNGVVNTPLFRHLGSSSWHEKDARFIKAFANMDQRVAFGM
VLFALVGGCWAVSLCVSRCRAWHQREAISQEIEMLRKAHGS

Enzyme Prediction     

No EC number prediction in ATCC64974_42750-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	94	174	9.2e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.84e-25	67	287	72	289	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.85e-15	94	177	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44892.1|GT32	3.54e-235	1	316	1	316
BCS05573.1|GT32	1.91e-233	1	341	1	341
BCS17124.1|GT32	1.91e-233	1	341	1	341
UDD65563.1|GT32	8.18e-140	1	321	1	321
QMW48357.1|GT32	1.16e-139	1	321	1	321

PDB Hits     

ATCC64974_42750-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	5.83e-38	77	291	55	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.35e-36	74	286	54	262	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	3.88e-36	62	291	50	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.32e-33	65	316	45	295	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.17e-32	67	286	72	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.977949	0.022067

TMHMM  Annotations     

Start	End
10	32
217	239
295	317