CAZyme Information: ATCC64974_42330-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_42330-t41_1-p1
• CAZy Family: GH171
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45845.03	4.7920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000006.1:1057724-1058950(-)

Full Sequence      

MQLKTPIPAIPSMPAMPAMSGVCLPRQVRRVVPLFLAVFCLVFYLSLTGTFAEFHGGLAR
QSKCRLFPRKIWQSWKVNPFEFEERDLNVARTWTSINPGYRYEVLTDQNDLHYVETNFGP
DGLNRPDIVETYRSLTAKIIKADLLRYLVMYVDGGVYADIDVEALRPLERFIPERFNEAD
MDLIIGVEIDEPDFNDHAILGPKSQSFCQWTFISKPRQPVMMRLVDRILEWLHDHSVKQG
KPISDLELDFDDIISGTGPSAFTEAVLAEMSARTGQEVTWKTFHDIPESKLVGGILVLTV
EAFAAGQGHSDSGNHNARSALVKHHYHASGWPNTHPRFKHPLYGEVEQCNWNKQCVADWD
ANTAAFAALSPEEQEQQIAMKQAADAAEAEMAVEDLAGDDGDLGLAIE

Enzyme Prediction     

No EC number prediction in ATCC64974_42330-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	88	173	5.9e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.61e-23	67	232	82	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.71e-14	84	174	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96510.1|GT32	1.02e-296	1	408	1	408
BCS17076.1|GT32	2.77e-291	1	408	10	414
BCS05523.1|GT32	1.22e-289	1	408	111	515
QMW40889.1|GT32	6.39e-220	20	386	2	370
BAE58544.1|GT32	6.39e-220	20	386	2	370

PDB Hits     

ATCC64974_42330-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	9.06e-36	68	331	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.42e-31	67	329	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.50e-31	67	303	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.04e-21	68	329	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	8.14e-09	68	172	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999864	0.000126

TMHMM  Annotations     

Start	End
31	53