CAZyme Information: ATCC64974_41050-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_41050-t41_1-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270		28587.77	4.6235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000006.1:658173-658985(+)

Full Sequence      

MTRSIFIHTLLALSALTSVHGANSPGCGKNPTLANGVHQINGREYTLKIPDDYDANNPYH
LIFGLHWRGGNMDNVVSGDSIQPWYGLESRAQGSAIFIAPNGLNAGWANTNGEDVAFIDA
IMEQVESDLCVDQSSRFATGFSWGGGMSYSLACSRAKEFRAVSVLSGGVISGCDGGNDPI
AYLGIHGINDPVLPFDGGVELAERFVGNNGCQPASIEKPQSGSNGWKRTDFYGCSKPVSF
IAYDGGHDGAPLGVQSSLAPDATWEFFMAA

Enzyme Prediction     

No EC number prediction in ATCC64974_41050-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	43	171	8.4e-21	0.5814977973568282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	3.76e-15	42	267	46	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	6.19e-08	45	226	176	363	Predicted peptidase [General function prediction only].
223489	DLH	9.27e-06	118	194	96	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
223477	YpfH	0.003	113	205	78	172	Predicted esterase [General function prediction only].
224423	DAP2	0.003	38	204	376	576	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX54170.1|CBM1|CE0	2.30e-91	22	267	92	352
QSB17085.1|CBM2|CE0	2.08e-90	26	267	38	285
AYC36484.1|CBM2|CE0	8.98e-85	22	267	42	302
QBZ61811.1|CBM1|CE0|GH27	3.00e-84	21	267	704	965
SHH50044.1|CBM2|CE0	3.01e-84	8	267	33	311

PDB Hits     

ATCC64974_41050-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYU7|FAEC_ASPNC	1.25e-207	1	270	1	270	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	1.19e-171	1	270	1	270	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|B8N7Z6|FAEC_ASPFN	7.79e-161	1	270	1	270	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	2.60e-159	1	270	1	270	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2
sp|A4D9B6|FAEC_ASPFU	1.54e-156	1	270	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999760	CS pos: 21-22. Pr: 0.9790

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_41050-t41_1-p1.