CAZyme Information: ATCC64974_39800-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_39800-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	OGUI01000006.1|CGC2	46989.89	3.7925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000006.1:268652-270156(-)

Full Sequence      

MPALPILALALAPLLVNGQLSGSVGPLTSAHSKAATKTCNVLDYGAVADNSTDIGSALSE
AWDACSDGGLIYIPPGDYAMDTWVSLSGGKATAIILDGTIYRTGTDGGNMILVENSSDFE
LYSNSSSGAVQGFGYVYHREGDLDGPRILRLQDVSNFAVHDIILVDAPAFHFVMDDCSDG
EVYNMAIRGGNSGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGG
CAMGSLGADTDITDILYRNVYTWSSNQMYMIKSNGGSGTVNNTLLENFIGRGNAYSLDVD
SYWSSMTAVDGDGVQLSNITFKNWKGTEADGAERGPIKVVCSDTAPCTDITIEDFAMWTE
SGDEQTYTCESAYGDGFCLEDSDSTTSYTTTQTVTTAPSGYSATTMAADLTTDFGTTASI
PIPTIPTSFYPGLTAISPLASAATTA

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	72	372	8.1e-51	0.9323076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.35e-19	146	370	85	313	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.41e-18	40	375	48	392	polygalacturonase
215120	PLN02188	6.04e-18	29	372	27	390	polygalacturonase/glycoside hydrolase family protein
165802	PLN02155	3.25e-17	32	374	21	380	polygalacturonase
215426	PLN02793	3.74e-17	19	374	36	411	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41025.1|GH28	0.0	1	446	1	446
CAA63911.1|GH28|3.2.1.171	0.0	1	446	1	446
AIN75624.1|GH28	0.0	1	446	1	446
AAB35485.1|GH28|3.2.1.171	4.43e-256	1	440	1	439
CAB58937.1|GH28|3.2.1.171	4.43e-256	1	440	1	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	4.11e-253	19	440	1	421	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	5.75e-18	26	362	9	365	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87160|RHGA_ASPNG	0.0	1	446	1	446	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	0.0	1	446	1	446	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|Q00001|RHGA_ASPAC	7.87e-257	1	440	1	439	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	1.96e-250	7	442	6	441	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|B8NK45|RHGA_ASPFN	3.89e-238	1	443	1	444	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999705	CS pos: 18-19. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_39800-t41_1-p1.