CAZyme Information: ATCC64974_37230-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_37230-t41_1-p1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		32575.05	4.5295

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000005.1:1313643-1314705(-)

Full Sequence      

MLSTHLLFLATTLLTSLFHPIAAHVAKRSGSLQQITDFGDNPTGVGMYIYVPNNLASNPG
IVVAIHYCTGTGPGYYSNSPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNS
NSIANMVTWTISEYGADSKKVFVTGSSSGAMMTNVMAATYPELFAAGTVYSGVSAGCFYS
DTNQVDGWNSTCAQGDVITTPEHWASIAEAMYPGYSGSRPKMQIYHGSVDTTLYPQNYYE
TCKQWAGVFGYDYSAPESTEANTPQTNYETTIWGDNLQGIFATGVGHTVPIHGDKDMEWF
GFA

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	46	244	8.8e-19	0.8105726872246696

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	3.49e-37	47	259	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.77e-23	38	290	40	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	3.17e-20	49	237	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	4.90e-08	47	174	382	508	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	1.68e-04	89	174	14	99	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMQ81177.1|CE1	2.14e-229	1	303	1	303
AAK60128.1|CE1|3.1.1.72	2.14e-229	1	303	1	303
CAK46215.1|CE1	3.56e-228	1	303	1	303
BCS02633.1|CE1	7.07e-217	1	303	2	304
BCS14300.1|CE1	7.07e-217	1	303	2	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	2.94e-203	29	303	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96W96|AXE1_ASPFI	3.81e-230	1	303	1	303	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	6.32e-229	1	303	1	303	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q92194|AXE1_ASPAW	4.20e-216	1	303	2	304	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2
sp|Q4WBW4|AXE1_ASPFU	1.30e-173	25	303	25	305	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	2.36e-173	25	303	25	305	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999687	CS pos: 23-24. Pr: 0.9746

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_37230-t41_1-p1.