CAZyme Information: ATCC64974_36720-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_36720-t41_1-p1
• CAZy Family: GH142
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964	OGUI01000005.1|CGC7	104384.99	6.1420

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000005.1:1149433-1152503(-)

Full Sequence      

MQQLAVRVTHREAVVPPTRYEIGSGFTNYTGYGNASCFTLDQKSPLVTLDYGTEVGGFPL
FHVDFLSTAVQLEAKYTESKTGLDEPFGDGPWTFSNGLSNTFRVETFNVNSPGTVESFFI
QGGLRWQNLKLLTEGSVRICQAGIRSQNDRTAVDKLPGYFESSNNLYNEIWALGPRTVQQ
ACIAADTAPSTWEVTGDGVYLRGQQPAQSVAGASFSNYTMTFQTNIVRGGTGWKVATGVG
GFGPYFVLTSEYPVGSTFVNTNRTIVPPNSLAVGYGWNLVNQTSLTTGKVNHYSLPFNIK
EGQWYEISTSINATGYGVTINGTEIFVALDDLQIVAGTTGSSGSLTGGTWGFGPYQDQIA
LVKDVTVHAQNGTMLYQNPMTLSSVLEEYGVMANKHSVCLDGAKRDRLVWSGDFVHTYRV
IQSSTYRSDFITGSLEYWIGRQAPDSSQYAGYFSMSPAMGQSAKYVDTYASFGLLDYQLF
LLNVFAGHYRNSGDKAFVTKHWAKIKKGVEAILPLIDDQSGLAVATDIGAFFSGSDNGTA
VSALLAHTLDQMADVASAMNETDVATTWTRSATSVKAAIRQQLWNHRLGYYATDLSDPTE
QSITGSAWAILAGVANATQAESSLAALSSLRLGIGYKTTSSVANASSTNLAPFLTGFLLE
AIMQESRNSPSSSKARTTAIGVLLDQLWAAMVTQNEYYTGTTWEYLYPDGRPGLDFYTSH
AHPWAAAPTYVFSEYVLGVQATSAGFSEWEFRPAMLDVNLSWARGRVPTPQGPIQASWQL
NETSVQLSVCGPSGTEGVVRVPFAIKSYSVDGEQQTNDKDGLEVQVSGGSCTDIHAVRGH
DKMQKIARSPDSEQMPRVGFVPAKPKLIANFSPLPQPSNAANRKPDSMRSEGHAAGHGIS
ACLVAFHNQQSSRNPGLASAWATPYGLFAFFQQLSSLLIKHMACFSALIIPKPQKLGLLQ
MQVE

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	388	800	2.2e-71	0.746031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.51e-12	389	736	22	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.01e-09	738	814	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
273702	oligosac_amyl	3.25e-04	407	605	293	484	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46278.1|GH78	0.0	11	839	28	832
ANZ93894.1|GH78|3.2.1.40	0.0	1	839	29	888
BCS14345.1|GH78	0.0	1	838	29	866
BCS02687.1|GH78	0.0	115	838	2	725
BCR89915.1|GH78	0.0	6	837	19	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.21e-08	400	774	331	672	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.28e-08	401	737	237	543	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

ATCC64974_36720-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996793	0.003241

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_36720-t41_1-p1.