CAZyme Information: ATCC64974_3630-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_3630-t41_1-p1
• CAZy Family: GH13|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	OGUI01000001.1|CGC12	57932.64	4.0364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:1100290-1102145(-)

Full Sequence      

MLLDKLSVLSFLGLAPIFAAAQLSGSVGPLTSASTKAATKTCNVLDYGAKADKSTDLGAP
LASAFADCKSGGLVYVPSGDYALSTWARLSGGEAWALQIDGIIYRTGTDGGNMIYIEHSS
DFELFSSTSEGAMQGLGYEFHADDNWSGPRLLRLYEVTDFSVHDFILVDSPSFHFSLDTC
TNGEIYNMAIRGGNHGGLDGIDVWSNNIWVHDVEVTNKDECVTVKSPSKNILIESIYCNW
SGGCGMGSFGSDTNVSDITYRNIYTWSSNNMMLIKSNGGSGFVENVLLENFIGHGNAYSL
DIDSYWASMSAVDGDGVQLSNITVKNWKGTEAYGAERGPVKVVCADGAPCYDITIEDFAM
WTEEGDSQWYSCESAYGSGYCLQDSDDHVSYSVTTSTVSSAPSGYSATSMAADLTTDFGS
TVSIPIPTIPTSFYPGATPYSALMANSASTAAASSIASHATVHSSSASVAASVPSAVAPS
ESIPAATSAVVSSAAAIAPSPAVGAQEGSTTSAPSFAAPSGAGNSPQGPTGASGFGEKGQ
QGEQGEQGEQGEQGVCYV

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	64	375	9e-55	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	2.96e-20	43	386	48	397	polygalacturonase
395231	Glyco_hydro_28	1.72e-19	149	373	85	313	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
165802	PLN02155	1.29e-16	35	377	21	380	polygalacturonase
215426	PLN02793	5.36e-16	149	404	177	437	Probable polygalacturonase
177865	PLN02218	2.34e-15	33	356	60	404	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48512.1|GH28	0.0	1	558	1	558
CAA63912.1|GH28|3.2.1.171	0.0	1	558	1	558
BCS11707.1|GH28	0.0	1	529	1	529
BCR99404.1|GH28	0.0	1	529	1	529
BAE66335.1|GH28	9.35e-277	1	451	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	2.30e-234	22	443	1	420	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	3.31e-16	52	368	26	368	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R3G4|RHGB_ASPNC	0.0	1	558	1	558	Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgB PE=3 SV=1
sp|P87161|RHGB_ASPNG	0.0	1	558	1	558	Rhamnogalacturonase B OS=Aspergillus niger OX=5061 GN=rhgB PE=1 SV=1
sp|Q2TWN8|RHGB_ASPOR	1.66e-277	1	451	1	453	Probable rhamnogalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgB PE=3 SV=1
sp|Q0CFC7|RHGB_ASPTN	3.61e-275	4	452	4	451	Probable rhamnogalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rhgB PE=3 SV=1
sp|A1DED1|RHGB_NEOFI	5.25e-270	1	452	1	452	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999676	CS pos: 21-22. Pr: 0.7340

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_3630-t41_1-p1.