CAZyme Information: ATCC64974_35660-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_35660-t41_1-p1
• CAZy Family: GH135
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		64925.40	5.1511

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000005.1:842635-844500(+)

Full Sequence      

MSSSLHAPFEADYVIVGGGTSGLVLASRLSENDSTRSVIVLEAGKNLIDDPRVQTPALWT
TLMGSETDLQFKSTPQAALNNRVIKEPQGKVLGGSSGINGQAFIAPTKAGIDAWNKLGAT
GWTWENLAPYYKKATTLQLPDEPTRNHIGVGWVDPEVNGSSGPIKVSFPAVKESPMAKAW
VEAFQGMGYGCTADPFSGVSTGGYSNLASVDYEKKQRSYAATGYGLPAMGRQNVKILTEA
TVQKILFSTSDNGAMAVGVEAKIDGQTVTVKARREVILTAGAVNTPKLLELSGIGDKERL
EQLSIPVIVENSNVGENLQDHLMTGISFEVKSGIATGDPLLRQEPETIQTAFQLYSEQKT
GPMTIGGIQSSAYMPLTDHSGQPEARQAYLDSFPPVANERDQVIRDIYTQEHEPTCQMFM
FLAQANLHESGKSFVGQNLLPGNFLSLGITQNLPFSRGAVHIASADPTVPPIIDPRYFSH
PLDLDLMARNLLSVERLHNVKPIADYLVESGQRNHPDAFLTDLESAKKYLRDTATTSYHL
SGTAAMLPQEKGGVVDENLRVYGTTNLRVCDASIFPLIPAANPMSTVYAVAERAADIIKA
EQ

Enzyme Prediction     

No EC number prediction in ATCC64974_35660-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	600	1.6e-182	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.45e-111	10	599	5	532	choline dehydrogenase; Validated
225186	BetA	1.30e-110	10	602	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.16e-42	454	594	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.77e-38	12	587	57	565	Protein HOTHEAD
366272	GMC_oxred_N	2.07e-36	77	322	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46356.1|AA3_2	0.0	1	602	1	602
QDL52568.1|AA3_2	0.0	2	602	3	603
BCS02826.1|AA3_2	0.0	1	602	1	602
BCS14479.1|AA3_2	0.0	1	602	1	602
QSS68114.1|AA3_2	1.20e-263	3	601	2	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	9.78e-83	12	599	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	5.33e-70	10	602	1	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.77e-69	10	602	2	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.01e-65	13	601	8	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	2.66e-60	10	598	35	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	9.23e-102	5	599	10	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	9.23e-102	5	599	10	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.23e-97	12	601	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	4.41e-97	12	598	48	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.41e-97	12	598	48	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_35660-t41_1-p1.