CAZyme Information: ATCC64974_33540-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_33540-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		28202.20	4.9519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000005.1:139762-140907(+)

Full Sequence      

MTLPKSGVLVPLYIYPLTPTTWDPLYNAIAAYPDLEFLVIVNPNSGPGALPCPDANYARE
VARLNACPNVYPIGYIRIDYCRKPLAVACEEIDRYASWAAEYATTGLGVGGIMVDETPNH
FNAAQAEYLRALHSHIKACSGLLRDRLVVHNPGTPPDPEMADAGSDLLLVCEEPFARWQT
NEVQHRLGELPYPRDRCGYMVTEVPNHHIPALVRDLRRRAAYIFVTEIVGDFYERFGPSS
WGILMETLSELGQ

Enzyme Prediction     

No EC number prediction in ATCC64974_33540-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	8	245	3e-80	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	1.02e-98	13	248	1	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41389.1|GH135	3.33e-192	1	253	8	272
BCS03089.1|GH135	1.99e-187	2	250	5	253
GAA87858.1|GH135	1.99e-187	2	250	5	253
BCS14735.1|GH135	1.99e-187	2	250	5	253
EHA25033.1|GH135	4.86e-169	29	253	256	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D6T_A	1.73e-50	4	249	24	271	Crystal Structure of Aspergillus clavatus Sph3 in complex with GalNAc [Aspergillus clavatus NRRL 1]
5C5G_A	2.08e-50	4	237	6	242	Crystal Structure of Aspergillus clavatus Sph3 [Aspergillus clavatus NRRL 1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11113|SR4_PHYPO	5.16e-15	8	169	99	242	Spherulin-4 OS=Physarum polycephalum OX=5791 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_33540-t41_1-p1.