CAZyme Information: ATCC64974_32060-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_32060-t41_1-p1
• CAZy Family: PL27
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795	OGUI01000004.1|CGC19	84904.49	5.9872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000004.1:1679821-1682482(+)

Full Sequence      

MGTLPTWLSALLLLLWTAAAQSPAIDVAGTIADPNPHGPTMSGTPSDCNRWFTIKKGDTC
YELEKAFGLTPQQFQQWNPAVSHDCLVNFWPGYAYCVGIGPVAIPTSADTAPHAPTMTGI
AANCNRWYTAQKGDNCYAVEKAFGLTPQQFQQWNPAVSLDCLVNFWAGYAYCVGVGPAAN
GPHGPTMPGIAPNCIQFYTAKKGDTCYAVEKAFGISPQQFQQWNPAVSLDCLVNFWPDYA
YCVGVGPVAPTLTSTVTATATSASTSTTLTTSTTSTTSTTALPTSTTSTAWTTGTSTTST
SLAPTTVFTTFTTTLTLTTTLTSNGQTTVIVTTTVTTTVSPSTTIGTFTTSTTALPPSTT
SSSTTSTSSASTTVTSSTSDTSTTLTSPSAPTTPRTVTSTTPRSPSITPTPSTMVTTNPN
YSTRNPITSYNQTITPIDTAWPPTKTHPGQPKNCDKWHLVAPGDTCRSIYQRHGNRITMD
ELLEWNPDLKADCDYPIAGYWVCVGIKRPALTIIYPTTNGTAPDPTPWTPRPLPTETAVY
PPTKTQPGLAPSCSAYYEAQPSDTCDQILASNPMLKFPLLFEWNPALKADCSGILPGYFY
CIAAYNSTNLPSPPTVTNQPYPMKAGTAKNCTAWYKKEDGDTCDLIVEMFGTFDKAQFVA
WNPAVGVKCIGLENGYYYCVADPSTPKTRTRPVSTTVTFPTAHPRQPGVTKDCNKWWLVS
VHDDCYDIIHFNGITMADLYTWNPALSGKRNCLEGLVPDMEICVGVSSMSTTTASSTVPG
ISGSTGLVTIVGGRD

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	7.82e-09	196	232	1	37	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	8.13e-08	126	162	1	37	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.41e-07	53	86	4	37	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	3.36e-06	197	230	1	34	Lysin motif.
180536	PRK06347	9.13e-06	34	228	388	580	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK42252.1|CBM50	0.0	1	794	1	794
BCS02341.1|CBM50	1.04e-257	422	795	9	386
BCS14019.1|CBM50	1.04e-257	422	795	9	386
BCS14018.1|CBM50	7.43e-161	1	247	1	253
BCS02340.1|CBM50	7.43e-161	1	247	1	253

PDB Hits     

ATCC64974_32060-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.67e-24	542	766	144	373	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.30e-22	34	175	355	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	5.45e-11	451	612	26	189	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	5.91e-11	553	680	268	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	7.91e-09	446	506	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999752	CS pos: 20-21. Pr: 0.9746

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_32060-t41_1-p1.