CAZyme Information: ATCC64974_29050-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_29050-t41_1-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	OGUI01000004.1|CGC3	69766.88	5.0892

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000004.1:770503-772741(-)

Full Sequence      

MLSTITSFLILLFFVTTVSAYPFEENSFPRLQDTLATGTKPGDPPKFGGGYDYVVVGGGT
TGLLVASRLAKAGNSVAVIENGTYPTGNLTTVPGYNEQWFSRVLPSNWTDMVNVWPTVQQ
VGGGEQQHMMGRMIGGSQGFTFVDYFRTTKGAMKRWADETGDDSWTWENVQQYYKKSFKF
TPLNNTARPSNATPDYESSQIVGSTPGPLELTFPKYAQAFGSWVKLGLNELKAGINRVFV
EGDIKGASWILNMIDSQTGNRATTYTAFLEPTQKDDTSKIDVYVETLAERTLSNTPPGSD
PVTIGVLVKRWGMRFPIFAGKEVILAGGPILTPQFLMVSGIGPQDHLQEMNITVLANRPG
VGQNYNDHILFGVKHAVQVETTSVLLNDTRKWQECERFKAHADGMLADPGPDFAAFVDYP
EDIRQNLSAQTKSDLSQFPSDWPDIGIVSSPLGVNGDGNHNYADLVCIPMKPISKGTIKL
RSKSMDDKPVLDPQWLKSPTDMDTAVAGLQYLLRLYGTNSMKPILNASGKPIDLESSNKD
DLIKYVKNNYRTLNHQSASCRMGKRDDPMAVVDSKGKVIGVDRLRIADPSAWPFLPAGFP
LGTAYMFAEKIADNILSDHGSDKDEDEDELRVEL

Enzyme Prediction     

No EC number prediction in ATCC64974_29050-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	51	617	1.5e-157	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.69e-61	51	620	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.67e-55	51	616	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.64e-38	472	611	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.31e-19	8	618	8	579	Protein HOTHEAD
366272	GMC_oxred_N	8.48e-13	130	368	23	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP40103.1|AA3_2	0.0	1	634	1	664
CAK42459.1|AA3_2	0.0	1	634	1	664
CAK43129.1|AA3_2	2.93e-160	20	634	20	637
AUS76865.1|AA3_2	3.06e-122	15	616	17	611
QKX54324.1|AA3_2	2.51e-113	45	617	41	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.27e-40	51	618	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.99e-40	51	618	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.84e-35	51	619	6	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	3.55e-35	41	609	32	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	2.77e-32	51	617	14	528	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2V5GRB0|PYVF_ASPV1	2.38e-129	43	621	40	620	Dehydrogenase pyvF OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvF PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	4.22e-112	51	615	51	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.65e-107	51	612	52	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.03e-103	51	618	36	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A4UHS8|VBSA_DOTSE	2.08e-97	51	617	76	645	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001163	0.998819	CS pos: 20-21. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_29050-t41_1-p1.