CAZyme Information: ATCC64974_2570-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_2570-t41_1-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	OGUI01000001.1|CGC5	56555.89	4.7935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:794816-796524(+)

Full Sequence      

MYAMSPSSTKPPAISLFTCRALQSFNWENWPRENENCTIEANPSSVCGQGRIPLYSAVIQ
SVDEICAVVKFAKQRNIRLVIKNTGHDSTGRSGAPHSLQILTNRLKDITFHDDFVPSQGD
LGMDNPNASGVPAVTIGAGVMVGELYAAAAARGLIVVAGECSTVGVAGGYLQGGGVSTVL
SPMYGLAVDHVLELEVVTAQGEIVTANGYQHDDLFWALRGGGGGTYGVVTKATMRAFPDI
PAVIPTVHFIYPRANDVFWQAVAQVVRLTQSMSVNGNSGQYIVGHLPNYHWYVNWTMFVW
DDTESELVEEQIPPFLRFLDWFGIEYQYELAEYSKISAFLTIPKQVDIGGIGYLQSSVVI
SESFMNSTAGASRLTASFSKLMLDPGALITVNVLGGQINLNAKDEDASVNPLWRSSSLLV
VLMQSFPPTPEAQSAAHQTLSQTNTPILASIDPEGGGVYFNEADPDQSDFQNAFWGHHYG
RLRRIKSRWDPAGLFVVRNGVGSEDWDVESMCRKETMVPA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	52	272	3.9e-47	0.42358078602620086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.46e-20	56	207	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	6.48e-12	51	495	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	4.34e-10	458	502	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	5.33e-05	56	217	66	220	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	2.70e-40	42	507	587	1055
QKD57322.1|CBM91|GH43_11	2.70e-40	42	507	587	1055
ANH22774.1|AA7	1.57e-17	3	501	19	494
QUC19098.1|AA7	1.79e-17	60	495	55	462
UNI23960.1|AA7	7.64e-17	61	495	56	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.20e-62	33	513	104	573	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	5.93e-37	47	514	120	598	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO4_A	1.51e-16	136	256	116	231	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	1.51e-16	136	256	116	231	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
5K8E_A	8.90e-16	51	501	56	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E1ACP9|NOTD_ASPSM	4.66e-140	21	512	96	587	FAD-linked oxidoreductase notD OS=Aspergillus sp. (strain MF297-2) OX=877550 GN=notD PE=1 SV=1
sp|L7WR40|NOTD_ASPVE	4.12e-139	21	515	96	582	FAD-linked oxidoreductase notD' OS=Aspergillus versicolor OX=46472 GN=notD' PE=1 SV=1
sp|C5FTN2|EASE_ARTOC	1.45e-124	22	518	99	594	FAD-linked oxidoreductase easE OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) OX=554155 GN=easE PE=3 SV=1
sp|L0E159|MALF_MALAU	1.52e-124	21	514	90	578	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1
sp|D4AK47|EASE_ARTBC	4.42e-124	22	509	6	492	FAD-linked oxidoreductase easE OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=easE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000022

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_2570-t41_1-p1.