CAZyme Information: ATCC64974_2550-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_2550-t41_1-p1
• CAZy Family: CE2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	OGUI01000001.1|CGC13	41509.66	5.9576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:786299-787396(+)

Full Sequence      

MASTSPPAVRSKIDLLITNLVNIQDKTGQFLLPLADGRIIDTKSWHGWEWTHGIGLYGIW
KYYEMTGSPHLLQIIEDWFAARFAEGGTTKNINTMAVFLTLAYVYEKTQNPVYLPWLDAW
AEWAMHELPRTKQGGMQHATYLTENYQQLWDDTLMMTVMPLAKIGKLLNRPDYVEEAKRQ
TLVHVKYLVDTSTGLWFHGWTFEDGGHNFARARWARGNSWVTMVIPEFVELLDLKEGDPI
RLFLLDTLEAQCEALMGLQEESGFWHTLLDHPDSYVEASATAGFAYGILKAVRKRYLPKK
YRVVAEKAIQAVLSAVDETGELQQTSFGTGMGDSLDFYKKIPLTAMPYGQAMAIMALGEY
LRGHL

Enzyme Prediction     

No EC number prediction in ATCC64974_2550-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	42	362	5.9e-112	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.83e-114	19	362	7	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.88e-105	22	362	1	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46529.1|GH105	1.39e-279	1	365	1	365
BCS11594.1|GH105	3.94e-270	1	365	1	365
BCR99290.1|GH105	3.94e-270	1	365	1	365
QMW46699.1|GH105	8.15e-229	2	365	3	366
QMW34630.1|GH105	8.15e-229	2	365	3	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	5.75e-173	9	364	26	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.41e-172	10	362	24	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	2.73e-169	9	362	8	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	6.38e-19	149	362	199	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	3.32e-55	48	362	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	8.16e-16	150	361	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.86e-08	165	319	10	169	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.86e-08	165	319	10	169	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_2550-t41_1-p1.