CAZyme Information: ATCC64974_1950-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_1950-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262	OGUI01000001.1|CGC14	26687.77	4.4588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:615794-616782(-)

Full Sequence      

MAPLKSLLLGASLATLALSTPLATDAENLYARQFGTGSTANELEQGSCKDVTLIFARGST
ELGNMGTVIGPPLCDNLKSKLGSDKVACQGVGGQYSAGLVQNALPQNTDPGSISAAKQMF
EEANSKCPNTKIVAGGYSQGSAVIDNAVQELSTTVKDQVKGVVLFGFTRNVQDHGQIPNY
PKDDVKVYCAVGDLVCDDTLVVTAMHLTYGMDAGDAASFLAEKVQSSSSSTTSSSSDAAS
SSSAAGTSSSGLSGLSSFFGGL

Enzyme Prediction     

EC	3.1.1.74:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	47	223	2.6e-45	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.08e-63	47	224	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41954.1|CE5	1.11e-165	1	262	1	262
CAG17929.1|CE5	1.11e-165	1	262	1	262
BCR99223.1|CE5	1.67e-152	1	262	1	257
BCS11530.1|CE5	1.67e-152	1	262	1	257
QMW46952.1|CE5	2.67e-111	1	227	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	3.20e-68	28	224	4	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.87e-67	41	224	5	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	5.13e-65	20	224	1	198	Chain A, cutinase [Malbranchea cinnamomea]
1CUA_A	2.35e-64	21	226	2	209	Chain A, CUTINASE [Fusarium vanettenii],3EF3_A Chain A, Cutinase-1 [Fusarium vanettenii],3ESA_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESA_B Chain B, Cutinase 1 [Fusarium vanettenii],3ESB_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESC_A Chain A, Cutinase 1 [Fusarium vanettenii],3ESD_A Chain A, Cutinase 1 [Fusarium vanettenii]
1CUG_A	2.35e-64	21	226	2	209	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R2W3|CUTI1_ASPNC	1.97e-166	1	262	1	262	Probable cutinase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An14g02170 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	1.93e-111	1	227	1	224	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1
sp|B8NCM8|CUTI3_ASPFN	3.88e-111	1	227	1	224	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q5AX00|CUTI3_EMENI	2.39e-97	11	224	9	219	Cutinase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut3 PE=2 SV=1
sp|A1D9W1|CUTI3_NEOFI	1.20e-96	11	225	9	216	Probable cutinase 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_030250 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000298	0.999674	CS pos: 19-20. Pr: 0.9358

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_1950-t41_1-p1.