CAZyme Information: ATCC64974_15720-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_15720-t41_1-p1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		54234.25	5.6148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000003.1:1355142-1356572(-)

Full Sequence      

MAPPLHRRSWRQSRASALIFAAAFFSAGFILFFYSRPSYVAPIPDLQTSPSLASPDDTNS
CFVDLDLLRQYSSTATVQYARLEIAVTPTENFTGYTDTLNTRFPKFHTVRLDTEAPREDL
SPEKCTATVTIEGPQPSAPPDASHIIFGLSTSTDRLIDSLDAFAHWAAGTNARILAVVDS
GGRKKEAERRAQALGIRLTILQEDNERLDRYFYLVQYLYKHRDKSTQWVVMMDDDTFFPS
MTRLVDRLATYDASMPQYVGAVTEDLQQMYSSGYMAYGGAGIFLSIPLLEQLQPWFDECY
VFKGGGDHMLSQCIYKHTNTKLSWERDLFQLDLRGDASGFYEAGRAQPLSVHHWKSWFQA
DMVALSKASSICGEACLLHRWLLQDEWYLVNGFSVIKYSTVSDDPLAMEQTWNASQYTGP
NPFTYSLGPLRRKDEKKISFRMRDVVQEKERVRQIYVHEVTPEELEVLEVVWNHAA

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	4.06e-13	227	353	212	341	hypothetical protein; Provisional
398362	DUF604	1.85e-08	267	353	1	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	8.74e-07	228	295	87	162	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44001.1|GT31	0.0	1	470	1	470
BCR96058.1|GT31	0.0	1	476	2	477
BCS08579.1|GT31	0.0	1	476	2	477
QMW36933.1|GT31	1.53e-191	10	473	10	468
UCK57270.1|GT31	2.17e-191	10	473	10	468

PDB Hits     

ATCC64974_15720-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATCC64974_15720-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000001

TMHMM  Annotations     

Start	End
13	35