CAZyme Information: ATCC64974_1480-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_1480-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		49846.16	5.6791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:471463-472853(-)

Full Sequence      

MAIPSITALGDDPNTEHRLNACAYQQSAITTSGSIQYVAFYTPREESDSRRVTIARHDLQ
DTSSNWQYLTFEDYDQTTDDGHNTISIGICAGDGTIHVSFDHHCDALKYRISRSGLANDT
SKSSWVASNFSPILDHLPGCDGLLDVTYPRFIPAAREMYFECRIGKAGAGSDVLYRYSPD
TAQFVHLGTYLVGRQCNPYPNGMSYHLPTNSLHVTWTNRHFIEYEGAKDGASTAHKAQAG
PNGPENNEGLYYAYSRDNGATWNGPSQKSVTVLSARPGTGLESQDSQLLVRNIPRNSGIM
NQEAQYVDSQGGVHVLNRENTTGKETWMHYYRSSSDNQWAFFALPEIYPTPTGPRGKLVH
SEKLNSVFFILPSNTGNELLIARRSMTDIDGEFRVVWREHGYSGEPLIDEEAFTKFELLS
VLILRDDKEGKRKVTVIQFDINELAQ

Enzyme Prediction     

No EC number prediction in ATCC64974_1480-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	19	340	2.4e-74	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	8.36e-61	36	339	2	266	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11483.1|PL42	1.07e-299	1	446	1	446
BCR99175.1|PL42	6.19e-299	1	446	1	446
UQC84206.1|PL42	4.06e-111	12	443	16	457
ATZ45789.1|PL42	2.46e-105	4	442	6	449
CCD45446.1|PL42	2.46e-105	4	442	6	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	7.93e-67	9	446	13	424	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	7.93e-67	9	446	13	424	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	1.76e-65	9	446	15	426	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MUM_A	3.51e-13	19	315	40	288	Glycoside Hydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]
5MUK_A	3.46e-12	19	315	35	283	Glycoside Hydrolase BT3686 [Bacteroides thetaiotaomicron VPI-5482],5MUL_A Glycoside Hydrolase BT3686 bound to Glucuronic Acid [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ATCC64974_1480-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.939780	0.060239

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_1480-t41_1-p1.