CAZyme Information: ATCC64974_13400-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_13400-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	OGUI01000003.1|CGC23	30375.23	4.1389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000003.1:688088-688984(+)

Full Sequence      

MKQAGSILALAGLVSLAQGHGFVTSPQARMPGSAMEKACGQQVYNNQEADNYGNVQGELQ
IASGQSDYNADACDIWLCKGYKYADNKDNVYSYTAGETVDFTVDIRAPHTGTANVSVVDT
ASNTVIGSPLIYWSVYASTSTGVTKNETSFSVTIPDDLGDKCTEGGACVLQWWWNAASID
QTYESCIDFTVGGSGSSSSSSSSSSSSSSSVAASQPTTTAAAAAVTTPSTANNVAPASSS
VPTTLATSVKQSATVAPVAASSAAAAASSGVSIPTDGTAEEQLTWVASLLKALLKYAN

Enzyme Prediction     

No EC number prediction in ATCC64974_13400-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	20	189	4.8e-74	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	9.56e-08	20	189	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK37296.1|AA16	7.84e-149	1	298	1	297
BCS05968.1|AA16	4.61e-146	1	298	1	299
BCR93324.1|AA16	4.61e-146	1	298	1	299
BCR86587.1|AA16	1.93e-107	1	296	1	268
UDD64172.1|AA16	1.78e-106	1	296	1	282

PDB Hits     

ATCC64974_13400-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATCC64974_13400-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999672	CS pos: 19-20. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_13400-t41_1-p1.