CAZyme Information: ATCC64974_1240-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_1240-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218		23832.06	7.3454

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000001.1:414003-414659(-)

Full Sequence      

MLSRVWYHDYLGNATAESGIKYVIGETNSISCQGAFNISDVMASAVWAVDYVMYLSSLKV
SRVHFHMGTRYRYSPWQPIVYNDSAPHVNPMYYGNLFNAAVFAGGNKQTEVLVNETNFGA
YAVYKSGSLDAIVAVNLNIWNSTLDPVARPYTALALPEIWKDAKVSRLTSPGVDIAGNIT
FAGQYVNENASIVGQKIYDKVTGGKVLVGAGEAILVQR

Enzyme Prediction     

No EC number prediction in ATCC64974_1240-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	14	178	1e-29	0.36043956043956044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.78e-17	120	215	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41913.1|GH79	1.57e-154	1	218	301	518
BCS11449.1|GH79	7.31e-140	1	218	223	440
BCR99142.1|GH79	1.28e-139	1	218	240	457
UDD56941.1|GH79	3.42e-138	1	218	223	440
BAE62550.1|GH79	2.14e-136	1	218	286	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BWI_A	2.75e-07	11	136	240	365	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]
5G0M_A	7.37e-06	11	191	272	444	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	7.44e-06	11	191	272	444	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	2.65e-19	19	217	317	530	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	1.70e-18	23	143	309	442	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999963	0.000087

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_1240-t41_1-p1.