CAZyme Information: ATCC64974_111080-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_111080-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		55775.85	6.6652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:4809883-4811685(+)

Full Sequence      

MGFVAGFDSDLEWNLRSVPQERAFGGDTVCLASGKIVGGGSGVNYQVYTRGPAVDYDQWA
DLVQDRRWSWNGLLPYFKRVETWYPSVEMKKRGLLTIDSHGDRGPIKVSHATNSGKPRNY
PLREKSRRFHEFLGRKQADDMNSGQQLGYSEAFSSSYAGLRSFASSYPLGSNVTLWTKAT
VERLIMAGRTAEGVAVARAVGDQIERVQVRARKEVILSAGAYGSPKILLLSGIGPAAELK
RHNITSVADLPVGKNYADHPHIFTYWTIDECNATLGDGEMETDQVHWLAGLPYDWMSFAP
ADTKTQEIAKKILSPTERSRYLADGKMQLENFIVYTAVDTSARKKPLEGWPGKRVISLMH
VLVDSVSRGTLTLRSSDPADAPVLDPKLLASPVDRSALYENVRETARAIQAVEGLNAVEF
GVDDSLRDNWSNEAIEVRANRSGGSTYHYSGTCAMGEVVDTECRVYQAERLRVVDSGIIP
LPLAAHYQAPTYGVAEQAADMILSSVA

Enzyme Prediction     

No EC number prediction in ATCC64974_111080-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	504	2.8e-114	0.903169014084507

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.07e-72	8	504	59	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.06e-67	34	503	85	532	choline dehydrogenase; Validated
274888	Rv0697	2.53e-43	31	503	78	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	7.36e-33	25	260	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.38e-30	367	498	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10581.1|AA3_2	0.0	1	507	51	552
CAK47171.1|AA3_2	1.01e-297	1	507	1	428
BCR98133.1|AA3_2	6.97e-147	280	507	1	228
BCR98132.1|AA3_2	1.54e-138	1	231	51	281
QKX63105.1|AA3_2	6.58e-126	1	505	473	974

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.91e-38	8	502	55	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.94e-38	8	502	56	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	6.90e-35	6	505	92	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	3.54e-34	34	502	87	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.80e-34	34	502	87	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.24e-57	9	504	56	520	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|A9M9H8|BETA_BRUC2	1.40e-42	12	503	59	526	Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=betA PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	5.01e-42	12	503	59	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|B0CKN4|BETA_BRUSI	5.01e-42	12	503	59	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	5.01e-42	12	503	59	526	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_111080-t41_1-p1.