CAZyme Information: ATCC64974_108200-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_108200-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	OGUI01000017.1|CGC9	70704.23	5.8659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:3928394-3930287(+)

Full Sequence      

MRTQRFVVWLGTFALISLCLILFRSSSPSPSPIVDLYPSPDSRPPTTLQRPPVPSNAQLI
EQTGYRKVAQPDSLHPVASLVKNAEQQFDRLLSRQSKTLAQAVDEYRERYNMHPPPHFDK
WFQFAKDRGVQLIDEYDTIYHALLPFWALEPKTIRDRARETLGFDNSMIGVLIRNGSVSL
VEGGAFEQGWQRSATAKMINSFVEYLPDMDLVFNALDEPRVVVPSEDLQRLVAIARDQVS
QNTVVNTMPINAWSDRPSDLNKGDRIDEVRTTRFNRFTRQSTWSYSRSSCPVDSPVRSLD
EQAADNINSYAQGELGFIYNTSAFSDICNSPSLRYKYGFFDRPNRFEAVHDLFPVFSQSK
ISSYQDILYPSPWYWSDQVPYEEDKDMEWDEKDSRMFWRGSTTGGYSRAGGWRRQHRQLF
VGKVNALNTAKILSKTESSQWKTRGVGRNSFTDLFDVRFTYIGQCDDKDCAAQEEYFDLA
EPVDQQDAWAYKHLLDMDGNAFSGRFYAFLRSRSLVHKVSIFREWHDEWLKPWKHYVPLS
LTGDDYLEAIRYFESEEEGRVIAPRLAQQGREWAQKALRSEDMEVWFFRLLLEYGRLVDD
NRHNLGFSV

Enzyme Prediction     

No EC number prediction in ATCC64974_108200-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	331	598	3.2e-83	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.53e-23	350	597	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	7.93e-12	354	597	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43248.1|GT90	0.0	1	609	1	609
BCS10289.1|GT90	0.0	1	609	1	609
BCR97835.1|GT90	0.0	1	609	1	609
UCK57446.1|GT90	1.03e-303	1	609	11	619
BAE54850.1|GT90	1.18e-302	1	609	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.24e-10	354	598	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	7.56e-10	341	601	105	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.29e-53	75	604	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	9.18e-12	354	598	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.19e-09	354	598	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.54e-09	346	598	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	2.59e-09	341	601	133	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000051

TMHMM  Annotations     

Start	End
7	26