CAZyme Information: ATCC64974_107930-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_107930-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	OGUI01000017.1|CGC32	74098.07	4.6552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:3850941-3853070(+)

Full Sequence      

MRWHKLLPGVLALLPLSVAQSCWRNTTCSGPTESAFSGPWEKNIFAPSSRTVNPEKLFLI
TQPDKTEEYSPFALHGNGSLVVYDFGKEVGGIVSVNFSSTGSGALGVAFTEAKNWIGEWS
DSSNGGFKGPDGALYGNFTEAGSHYYVMPDKSLRGGFRYLTLFLITSDNSTIQIEDVNLE
IGFQPTWSNLKAYQGYFHSNDDLLNKIWYTGAYTLQTNEVPTDTGRQIPAMAVGWANNCT
LGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDLDSVKNALQVMYDTQNNSTGAFDE
SGPPLSQKDSDTYHMWTMVGTYNYMLFTNDSDFLERNWEGYQKAMDYIYGKVTYPSGLLN
VTGTRDWARWQQGYNNSEAQMILYHTLNTGAELATWAGDSGDLSSTWTSRAEKLRQAINE
YCWDDSYGAFKDNATDTTLHPQDANSMALLFGVVDADRAASISERLTDNWTPIGAVAPEL
PENISPFISSFEIQGHLTVGQPQRALELIRRSWGWYYNNANGTQSTVIEGYLQNGTFGYR
SDRGYYYDTAYVSHSHGWSSGPTSALTNYIVGISVTSPLGATWRIAPQFVDLQSAEGGFT
TSLGKFQAGWSKTDKGYTLDFTVPHGTQGNLTLPFVSAAKPSIKIDGTEISRGVQYANST
ATVTVSGGGTYKVEVQ

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	80	633	5.9e-99	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	5.97e-14	195	468	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	5.33e-07	572	634	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	1.33e-05	117	511	155	562	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
273702	oligosac_amyl	3.57e-04	307	484	351	525	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
225990	COG3459	0.002	314	459	671	847	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	1	664	1	624
UCK57529.1|GH78	0.0	6	675	12	685
QRD88907.1|GH78	0.0	6	675	12	685
QMW37218.1|GH78	0.0	6	675	9	673
QMW25160.1|GH78	0.0	6	675	9	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.84e-18	157	604	273	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ATCC64974_107930-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001786	0.998189	CS pos: 19-20. Pr: 0.9524

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_107930-t41_1-p1.