CAZyme Information: ATCC64974_105530-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_105530-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	OGUI01000017.1|CGC2	43102.02	4.5370

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:3088762-3089922(-)

Full Sequence      

MYSLLGLLAALGCAQSALAAPLASPPNSSYIDWRTFKGNGVNLGGWLEQESTIDSLFWDK
YSGGASDEWGLCEHLGSQCGPVLEHRYATWITKADIDKLASGGITVLRIPTTYAAWIDLP
SSQLYSGNQTAYLKEIADYAIKTYNMHIIIDTHSLPGGVNGLTIGEATGHWYWFYNETNF
NYSMQVIDQVINFIQTSGSPQSYTLEPINEPADNNTNMVVFGTPLALTDHGAAWVLKYIR
AVVQRVESVNPNIPVMFQGSFKYPQYWEGDFPASTNLVFDTHHYYYEHMDSSSENLPEYI
LADAREKSGTGKFPVFVGEWAIQATYNNTLALRKRNVLAGLETWSSFSQGSSYWTAKFTG
NTSVAGQGEQKDYWCYETFIDEGYFN

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	367	3.6e-155	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.32e-08	90	321	24	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.58e-07	35	211	15	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39791.1|GH5_23	1.28e-297	1	386	1	386
QHN63926.1|GH5_23	1.74e-295	1	386	1	386
BCR97554.1|GH5_23	3.06e-280	1	386	1	386
BCS10017.1|GH5_23	3.06e-280	1	386	1	386
BAE61018.1|GH5_23	2.87e-199	1	386	1	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1A_A	1.48e-284	20	386	4	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6LA0_A	1.05e-195	20	386	1	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6ZB9_A	1.59e-11	37	385	2	386	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	8.99e-11	37	385	2	386	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.15e-28	14	320	12	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	8.66e-24	27	321	28	314	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|Q12628|EXG_KLULA	2.01e-21	18	378	18	395	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
sp|Q875R9|EXG_LACK1	8.25e-20	22	378	32	407	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
sp|O93983|EXG2_WICAO	8.03e-16	17	325	15	322	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999774	CS pos: 19-20. Pr: 0.9825

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_105530-t41_1-p1.