CAZyme Information: ATCC64974_105210-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_105210-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	OGUI01000017.1|CGC16	32781.66	4.5256

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:2994317-2995210(+)

Full Sequence      

MQLGDGKEEQDALQMMAFMNDASKTDSTSTSKDTMQDDSTLRVMIVGDSMSQGKEGDYTW
RYRIWEWFRAQHIAVQLVGPYTGTAPSEPQAHGEHQTTLGQPKTSGGYAPDVSPDFDRHH
FAVWGRTAAIDKDLIFDVLSAHQADLILLMLGFNDMAWFQSDASGTLDSIRTLVINARAA
NPNLKFAIANVPQRSLIPGREDIPFNTNIYNALLRNAIPAWSTADSPIHLVELQENYDCG
PDSCPAGYDGLHPNVVGEYQIARAFSLTLVKDYGFGGSPLIIPDNIPERPPSLSFNF

Enzyme Prediction     

No EC number prediction in ATCC64974_105210-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	41	266	8e-51	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.22e-41	117	269	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	8.30e-09	125	261	43	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	5.20e-07	119	265	39	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	2.54e-04	123	266	46	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	4.51e-04	137	264	70	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	1.57e-222	1	297	99	395
BAE63679.1|CE0	1.23e-121	40	296	56	317
BAE60780.1|CE0	1.39e-97	86	297	19	229
UKZ09962.1|CE0	8.88e-94	41	290	512	769
SCG40251.1|CE0	2.19e-88	41	296	336	597

PDB Hits     

ATCC64974_105210-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATCC64974_105210-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000054

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_105210-t41_1-p1.