CAZyme Information: ATCC64974_102690-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_102690-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	OGUI01000017.1|CGC37	42574.99	4.2876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:2190444-2191744(+)

Full Sequence      

MKGAAFLAFPASTLAGSVLWSGIFNSSYTVADFDEWSWSNQIAPWQWYIHGDGKTSEYLA
LSSDYKNPAASDAQGLRTRLVLPPPHAHNTFSHSTNTMNEQDSTSFWEGQSMQRTELIPQ
MSPSSSASDLGSGHLYYHFSLSASSTNPPSSSSEHQIAFFESHFTELQYQDNTLKWNAGG
DTHYSVELETGKWYNFAYDIDFDNQKVGLWASNGSDALTEVVSPVSASASSNGEDFHVGV
LSLTGDGTEDWFWSGVYIEKGDLTKSIGDGSSSESSSSGSATTTAQAVESTSSAAAAATS
AATTSVEATTAAAATPTQNVAVASSSTTSASTTSAATTSSESTAAATPSASNPVIATPSA
APSAAPSAAAASGSAALPVPTTASQILTDVRALLTALLARQGVHARDFAV

Enzyme Prediction     

No EC number prediction in ATCC64974_102690-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	18	270	6.8e-93	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.51e-52	18	264	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45436.1|GH131	2.99e-228	1	410	1	410
BCR97264.1|GH131	1.26e-176	1	410	1	385
BCS09730.1|GH131	1.26e-176	1	410	1	385
QMW46856.1|GH131	1.22e-110	7	272	8	256
BAE64574.1|GH131	1.22e-110	7	272	8	256

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	1.55e-70	16	267	1	240	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	1.73e-67	16	272	1	236	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

ATCC64974_102690-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.531288	0.468676

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_102690-t41_1-p1.