CAZyme Information: ATCC64974_100060-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_100060-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		66906.49	5.3798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:1339497-1341396(-)

Full Sequence      

MKRDTSSLSDIQPVYDYVVVGGGTSGLVVASRLTEDPAVSVLVLEAGSDRVDDPRIAAPG
LSASTYFDPEFDWGLISEPQEALNGRRLAQSRGRALGGSSAINMGMAIYPSRSDIDAWEQ
LGNPGWNWNSLSTYMRKSQTFIPPSDEVRDQLSLGYVDPDVQGTDGPIQISFGNGPFPAF
TAAWPRTFEALNHRLTGDPMSGRANGAFCNPATIHGTSRARSHAGVAYYTPEIAQRSNLR
VITEAFVEKVLLGKTNCVDDGQAIATGIQFRGNDGTQRTVAARAEVILAAGTIKTPHLLE
LSGIGDAKRLQEHGINTLIDNPNVGENLQEHGLVPFTWEAADGQITGEALRDPEVAKAAM
EAWQSSGAGPLGSHPLASAFMTLPELEKGELSGLIEKHLNAGGSARQTAQYRILRQFLED
ADEPTCQYTLAPFQMTPDKGPDPKGTFSMLEPGNYVSIIAVLNRPFSRGSVHLASSDPTE
LPTFDPRMLSHPLDLEIQARHVIWLETLAATEPMASLLKPNGRRLHYPTRVTSLETAREL
TRDRLLCHYHVLGTAAMMPREIGGVVDDRLRVYGCRNLRVVDASVIPLIPRGNIQTTVYA
VAEKAADIIKEDRLASL

Enzyme Prediction     

No EC number prediction in ATCC64974_100060-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	612	2.4e-178	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.11e-97	9	616	2	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.44e-89	15	610	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.24e-37	465	605	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.99e-28	82	331	13	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.02e-24	3	614	44	581	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40027.1|AA3_2	0.0	1	617	1	617
BCS13057.1|AA3_2	0.0	1	617	2	618
BCS01313.1|AA3_2	0.0	1	617	2	618
QGA17771.1|AA3_2	1.33e-304	4	613	5	612
BCS27275.1|AA3_2	4.99e-219	15	612	17	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.06e-81	15	612	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.91e-80	15	613	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.05e-79	15	613	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.72e-75	15	615	6	589	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3Q9T_A	1.42e-65	15	612	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.36e-97	11	612	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.36e-97	11	612	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.91e-91	11	612	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.36e-77	15	609	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.36e-77	15	609	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_100060-t41_1-p1.