CAZyme Information: ASPZODRAFT_99088-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_99088-t33_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	KV878345|CGC4	44575.34	3.8262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

Full Sequence      

MRLCFLFVSPCLAGSVLWSGIFNSTATVEDFDLWSWSNEIEPWQWYIHGTGNTSEYLGLS
ADYKNPAASDAQGLRITIDGTSFWEDQTMERSELIPQTAEDLGAGHLYYHFSLSTATTNA
PNASFEHQIAFFESAFTELQYGLEDGASGTSDNTLRWLAGGETYWSVQLEAGNWYNFAYD
INFDNQTVGLWASNNSDPLVLVVDAVAVTASSNSEDWHVGELRLPNGGVNSAAEDWFWSG
IYIEEAPLNTEIGSASAAASTTAASASTASTSSATSVATSTSTTAPTTSTTSTTSVSSTT
IPVSTEPASTSVPTSVSTSVPSAVSSSTTVAEISTTVVSTSESSAVATATPTEVSVSTST
EVSVATPTAVSISTATASSSTATSTASTSTVLPIPSGSASQILSELHAMLTSLLSRAGVH
ARDFNGH

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_99088-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	16	254	1.5e-93	0.9921568627450981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	5.24e-65	16	244	1	246	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.
411773	SP4_N	0.008	308	369	277	338	N-terminal domain of transcription factor Specificity Protein (SP) 4. Specificity Proteins (SPs) are transcription factors that are involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Human SP4 is a risk gene of multiple psychiatric disorders including schizophrenia, bipolar disorder, and major depression. SP4 belongs to a family of proteins, called the SP/Kruppel or Krueppel-like Factor (KLF) family, characterized by a C-terminal DNA-binding domain of 81 amino acids consisting of three Kruppel-like C2H2 zinc fingers. These factors bind to a loose consensus motif, namely NNRCRCCYY (where N is any nucleotide; R is A/G, and Y is C/T), such as the recurring motifs in GC and GT boxes (5'-GGGGCGGGG-3' and 5-GGTGTGGGG-3') that are present in promoters and more distal regulatory elements of mammalian genes. SP factors preferentially bind GC boxes, while KLFs bind CACCC boxes. Another characteristic hallmark of SP factors is the presence of the Buttonhead (BTD) box CXCPXC, just N-terminal to the zinc fingers. The function of the BTD box is unknown, but it is thought to play an important physiological role. Another feature of most SP factors is the presence of a conserved amino acid stretch, the so-called SP box, located close to the N-terminus. SP factors may be separated into three groups based on their domain architecture and the similarity of their N-terminal transactivation domains: SP1-4, SP5, and SP6-9. The transactivation domains between the three groups are not homologous to one another. SP1-4 have similar N-terminal transactivation domains characterized by glutamine-rich regions, which, in most cases, have adjacent serine/threonine-rich regions. This model represents the N-terminal domain of SP4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34786.1|GH131	QMW34786.1|GH131	2.46e-130	12	262	15	261
QRD91104.1|GH131	QRD91104.1|GH131	2.46e-130	12	262	15	261
UDD63765.1|GH131	UDD63765.1|GH131	2.46e-130	12	262	15	261
QMW46856.1|GH131	QMW46856.1|GH131	1.99e-129	12	262	15	261
BAE64574.1|GH131	BAE64574.1|GH131	1.99e-129	12	258	15	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	4LE3_A	5.65e-84	14	252	1	240	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	3W9A_A	8.97e-84	14	258	1	237	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

ASPZODRAFT_99088-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.289260	0.710700	CS pos: 13-14. Pr: 0.6695

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_99088-t33_1-p1.