CAZyme Information: ASPZODRAFT_97904-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_97904-t33_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	KV878343|CGC12	66748.04	7.3291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878343:761268-763268(-)

Full Sequence      

MQGIPGISATFDYIVIGGGTGGITLASRLALNNFRVALIEAGDYYEMKSLANIPGAVDIG
VGSDPHQTTLIDWGFVAKQVPGANGRDIHYPRGKCLGGSSALNFMIYQRPTKGTMEMWAD
QVNDSSYSFENVMPFFKKTVQFTPPNAVTRFANASARYKPDAFDPAGGPLHVSYSNYAQP
FSTWMDRGVIAVGIKRTEDFNSGTLFGAQYCSSTIRPSDQTRSSSERAFLKSSLPLGRLT
IYKNTMARKIIFNKYKKATKVRVSSFLLQFTLYAAREVIISAGAFQSPQLLMLSGIGPAD
ILHQHGIDVVSELPGVGQNMWDHVFFGPTYRVNVETLTKLANDVPYLAEQLLKYEATHTG
PLTNPVADYLAWEKLPNTSRSRFSSETERELSKFPSDWPEVEYVSGSGYVGNYSNLLTTQ
PRDGYQYATILGTLVAPTSRGNVTIASADPSHLPIINPNWLATRADQEVAVATYKRVREI
FHSEGMSPVVIGDEYFPGSRHSTDEEILEVIKNTVMTIYHASCTCKMGIKDDLMAVVDSK
ARVFGVQGLRVVDASAFPLLVPGHPQSVVCKFFHSRDHKLQVLFFLMCDFVDMLAEKIAA
DIITSS

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_97904-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	570	6.2e-178	0.9735915492957746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.83e-101	10	603	5	531	choline dehydrogenase; Validated
225186	BetA	1.34e-89	7	603	4	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.88e-38	437	569	1	136	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.19e-25	83	323	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.34e-18	277	569	281	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88023.1|AA3_2	9.71e-269	9	574	41	606
UCK58435.1|AA3_2	9.60e-265	9	569	41	601
BCR87370.1|AA3_2	1.95e-264	4	604	40	622
QKX64780.1|AA3_2	4.54e-260	7	606	38	615
QMW25940.1|AA3_2|GT4	1.60e-258	9	569	512	1072

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	3.33e-60	9	569	1	551	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	8.72e-60	11	569	2	550	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZE2_A	2.12e-51	7	567	2	569	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	4.05e-46	11	572	41	589	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZH7_A	7.46e-46	7	569	4	549	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	9.44e-185	3	569	44	613	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.81e-179	3	569	45	613	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	8.65e-176	8	567	38	594	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.43e-160	3	569	28	596	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	6.11e-138	3	572	38	585	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999890	0.000150

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_97904-t33_1-p1.