CAZyme Information: ASPZODRAFT_92515-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_92515-t33_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43733.82	5.1107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878339:312892-314064(+)

Full Sequence      

MATPEMLPTLQSPPRPFSYKEAFIPALTTQCHASNLLLLPNGDLLCAWFGGSMEGRPDIC
IYLSRLPAEQSSWMPAQKITHDHTRSEQNPILFLNPSDNQLWLLYTSQDAGNQDSAIVKY
HTSTDAGNTWSAEAHVLFPEPGTFIRQPLCVLSDGSWVIPIFKCRTEPGERWLGNDDISC
VQVSRDQGATWSEREVPNSYGCVHMAIRQLKDGSFLGLYRSRWADNIYLSTSDDGLQWSE
PVPTALPNPNAGICFDVLSSGRVVLVYNHSSRKDAQSRRDGLYDDIADGAGDGRSNQKSK
HAGKEAFWGAPRAPLCVAWSDDGGKTWEHRVLEDGDGYCMTNNSEKKLNRELSYPSMEIG
TDGTIHVAYTFWRQRIKYVQLQEDFFQQSD

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_92515-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	35	369	7.9e-23	0.8771929824561403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404074	BNR_2	1.70e-65	46	367	5	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
227036	COG4692	2.70e-57	21	382	23	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
271234	Sialidase_non-viral	2.02e-39	46	381	28	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13746.1|GH33	1.45e-208	9	387	10	384
BCS02060.1|GH33	1.45e-208	9	387	10	384
CAK97293.1|GH33	1.02e-205	10	386	11	383
QMW26624.1|GH33	8.86e-203	15	386	18	385
QRD87235.1|GH33	8.86e-203	15	386	18	385

PDB Hits     

ASPZODRAFT_92515-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPZODRAFT_92515-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_92515-t33_1-p1.