CAZyme Information: ASPZODRAFT_90575-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_90575-t33_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	KV878337|CGC4	57855.12	4.6743

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878337:2216610-2218285(-)

Full Sequence      

MKLTLSLALASATATATATATATSYDYIVVGGGPSGIITSTRLVEAGKSVLLLERGTGPT
VATGSNETLAWDSSLTAIDLPGLSFDIGALPQWDEYICTDTAGMAACVLGGGVTVNYMVF
VHPPAHDFDDNDYWPQGWKWADLEAAAERLYAVNNGTILPSADGKRYDQGMYDILSAFFA
AQGWTSVNMISQPDEKYQVYSHPAWNVKNQMRAGPVRTYLPVADKYPNFTLQMDTKVRRL
VRSGPTITGVEVETSSGEIDTIHVKKGGRVVLAAGALSSPRILFNSGIGPAEEIEMAAQG
NITVPPRKEWIDLPVGHGLKDHPIFSIIVQTNETAAFTVPDGEAIVNGSDTADIAAYTNH
HAGVLTQGKHRLTFFTSNVASDNITRYYQGSCAPTGAGKFTITAYMTHGLTSEGVLGLDA
DQNTVFLQSPYLQTEPDRQAATMFITEMVDAISAYPGFDLVTYPNVSSILASLTSGIHWT
GTTKMGTDNTSSVVDLNTKVYGTDNLFVVDGGIHPDLPTGNIQATIMVIAEAAVKRILNY
N

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_90575-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	539	3.8e-194	0.9872262773722628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.36e-55	25	541	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	7.35e-38	26	533	2	482	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	2.04e-27	25	538	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.54e-20	469	533	79	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.29e-18	108	324	26	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44335.1|AA3_1	3.77e-250	25	538	33	547
GAA84602.1|AA3_1	4.36e-249	25	538	33	547
BCR93747.1|AA3_1	4.36e-249	25	538	33	547
BCS06374.1|AA3_1	4.36e-249	25	538	33	547
QQK48042.1|AA3_1	6.48e-241	25	540	30	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NAA_A	1.98e-102	25	538	3	535	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	2.28e-102	25	538	8	540	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI7_A	1.25e-95	25	538	230	764	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	7.29e-93	25	538	8	543	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	1.13e-90	25	538	230	765	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	3.55e-99	25	538	235	767	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	1.25e-21	25	539	5	532	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	1.67e-21	25	539	5	532	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	6.16e-21	25	531	41	601	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|P46371|YTH2_RHOER	6.86e-21	26	533	8	485	Uncharacterized GMC-type oxidoreductase in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001961	0.998016	CS pos: 20-21. Pr: 0.6458

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_90575-t33_1-p1.