CAZyme Information: ASPZODRAFT_76622-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_76622-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KV878358|CGC2	47477.90	6.7181

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878358:142015-143403(+)

Full Sequence      

MSTIVVIACPPIPGHTNPLLPYAAYLRHQGGFEVHFIGGDAFAPAIMQTGSIFHQIEDSR
VPDSQHQLPPTPERLIDKVKHAFIDTTAHRMRSLQGVLESLRAAHPTREVVILQEIMFMG
VWPFLLDAPLPAGYSTFPTVITFNTAPLAVSSIDTAPFESGFPPDASPEGRARNVAMYAA
GKPLQDDLVNYANAIYSQLGAKQKMTSMDDWCYLSGRLLQPCSPSIEYPRSDLSPVVTFI
GGLSRKRNPIPIVLNLPGGLVSDKLSKKKRIVVVTQGTLVLDYTALIIPTICALADREDL
LVIALLGVKGASLPDIEIPSNTKVFDYLAYDAILPYTDVFVLNGGYGGFMHAVMHAVPME
IAGAGPDKAEVASRGEWAGIAVNMKTDRPGVGDLRRAIDKVMESKQMKSRCLHIQKENED
LNTLQQVERVIRGQT

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	13	426	2.1e-24	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	5.79e-28	1	432	1	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	1.66e-19	5	405	3	376	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39187.1|GT1	7.35e-143	4	431	18	452
BCS13313.1|GT1	2.14e-139	4	431	18	451
BCS01597.1|GT1	2.14e-139	4	431	18	451
UPK94024.1|GT1	4.53e-103	6	431	29	458
QGI99903.1|GT1	7.01e-100	11	431	37	461

PDB Hits     

ASPZODRAFT_76622-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	8.09e-80	11	431	27	454	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.34e-60	6	431	10	431	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	3.76e-52	5	431	7	427	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	1.38e-41	1	403	1	389	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_76622-t33_1-p1.