CAZyme Information: ASPZODRAFT_67626-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_67626-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
934		102484.76	5.6386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878343:197065-200530(-)

Full Sequence      

MKKALFCVSSIALAHVGYTQLFNQAGLRQRPLKNPLNDGRDTFLDELVMELTVPELVLQM
HLMFADNIIGPNGDHGSYDRMMQPAPSAAIGMIHDWYPTNTSQYNELQRLNALKARVNIP
ILQTGECLHGVGSFTLSMFPQAIGLAASFDTGLVHRVGRAIGVEASSIGVRACFSPVLDL
GKDPRWGRVQEAWGEDVVLTSHMGVAYASGLSKNSSWSDPDAVVPVMKHFAAHGSPQGGH
NGAPFFGYGHRSVLHEMLVPFKAAIDLGGVKGVMMAYNDLDEVPCSVNPLLYKALDEWGF
DGYITADDAGLLQLFNRHRVTSSVADTIAQWQNAGGMVQFYDFPLDQYVETFVDLVANST
VSIETLRSHVRRILGVKYDLGLFHNRYITAEVHPESITTAHQPLTLEAAHKTIVLLENRN
KLLPLDPGRQGLQRIALVGPFSDTFNHGDYSDQWGSAQTLHASTLRQGIMDHLEKHSPAT
ELITSWGANSWMYNAQYTIPPYLLTAQGQSGGLWATYYADSHFQDARFETLETPSRNWGI
YPPRDLPSNNFSVVWEGTLSVPVDTEVEGWLGVAVNRNNCARLYVDGVLLVEVRADNVLS
NIPGRSYSETNGTSPPPGSGPFTFRRGAQHTLRLEYQAWKYTGLVENMGSLNSQVLLFWN
LVDHPMVDSKQAVELARSSDVVVLAVGAAWNSDGEGGDRANLGLSPDQAALADAIFALDK
PVVMVLQGGRPFAIPEYYSKAAAVLNTFFPGQSGGQAISDALFGVINPGGRVPLSVPSSV
GTLPVFYNYKQTAERDYTDLSFQPVYPFGYGLSYTTFETGKFRATQSQFTPESTVTFRVD
ITNTGEVAGSYVAQIYLLGRVSSITRPVRQLVAFSRVYLDAGVSYTATLEVEVSRYLAIV
DRWDRWTVERGEYTFALLENGGMSVGPNVTLTCI

Enzyme Prediction     

EC	3.2.1.37:15	3.2.1.55:3	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	326	4.6e-50	0.9120370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.89e-110	1	894	1	728	beta-glucosidase BglX.
224389	BglX	8.00e-55	51	453	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.33e-49	116	901	78	752	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.01e-43	91	376	40	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	7.98e-38	641	814	49	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX64544.1|GH3	0.0	40	932	50	956
SMQ45870.1|GH3	0.0	39	934	37	947
SMR44393.1|GH3	0.0	39	934	37	947
SMR42219.1|GH3	0.0	39	934	37	947
SMY19547.1|GH3	0.0	39	934	37	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.15e-76	41	896	11	719	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.06e-75	41	896	11	719	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	2.97e-74	41	930	10	746	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5P_A	2.17e-68	34	913	29	746	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5I_A	2.38e-68	40	913	3	714	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	2.78e-78	38	893	32	727	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.84e-78	38	893	32	727	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	5.47e-68	116	917	62	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.07e-61	116	913	31	791	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	5.38e-59	45	914	41	737	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.973461	0.026571

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_67626-t33_1-p1.