CAZyme Information: ASPZODRAFT_60509-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_60509-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	KV878338|CGC8	43276.68	9.4127

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878338:1847940-1849274(-)

Full Sequence      

MGNLLQRHRPLRSLTVAFALWKLLLLLVLAACPGPGYDTSTTLLAGIGSLRNLVRWDPVY
FVHIAEQGYVFEQEWAFGYPRLQSDSPSEIALVGVALSHLSHYLSVLVLYGLSVTVLGRD
TPAKERVCLLAAALHIITPAGAFLSAPYGEPLFALLNFAGYYVYSSSTGPRRVGRLLGAA
ALFAVATTVRSNGILSGFLFASDAVRELHALVVHGCSVAALARLLLIVIGGCLVALGFVG
PQLLAYRDYCLTDTPRPWCQQALPSIYAWVQEEYWNVGFLRYWTVSNIPLFLLATPMLVI
LALSARWGVSTSSPISRRQPWLLAQLAIPQGLLALLALTSYHVQTINRISSGYPVWYWYL
AHQAVHGRRGATPTIRLITVYALVQAGLYGSFLPPA

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_60509-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	49	396	5.7e-98	0.8796068796068796

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.68e-39	48	396	52	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.27e-16	55	396	76	407	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82784.1|GT76	2.60e-150	3	396	13	465
QMW40534.1|GT76	4.40e-138	3	396	11	452
CAP97902.1|GT76	1.17e-137	2	396	15	450
QRD82967.1|GT76	1.77e-137	3	396	11	452
QMW28463.1|GT76	1.77e-137	3	396	11	452

PDB Hits     

ASPZODRAFT_60509-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	2.82e-137	3	396	11	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.05e-128	4	396	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	5.55e-94	3	396	2	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	7.12e-92	10	396	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.77e-52	13	396	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.023083	0.976924	CS pos: 31-32. Pr: 0.8930

TMHMM  Annotations     

Start	End
13	35
92	114
127	149
224	246
279	301
321	343