CAZyme Information: ASPZODRAFT_57113-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_57113-t33_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853		93554.04	7.1303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:2782835-2785575(-)

Full Sequence      

MQDSDLKKQVGQLFAVGFHGLTPSVEIKTLIREYGVGGVILFRRNIRDAEQLQALTLALQ
QEAKDAGHEHPLFIGIDQENGLVTRITPPIAPQLPGQMALGATHSPDLAYDVGKATGRIL
NFFGINMNYAPVCDVNSEPLNPVIGVRSAGDDPELVGRFASATSRGLREHKVIPSVKHFP
GHGDTAVDSHYGLPVIPKTRDQLERCELIPFRRAVAEGIEAVMTAHIALPAIGDGKYPAT
LSVDAMNILRKDMKYDGMIITDCLEMDGIRATYGTEQGSVLAFSAGSDSIMVCHTFDVQV
ASINKVCEAIQSGIVPQSRLEDALRRINRLKSSFLSWESALHREDLASLTALRSQTTAIS
EVAYSRSVTLVRQKPGVLPLPKDLPIVFLFPGAKTPAGGAVDGEGIRSQGSYKATEFSDV
LRLHNPLVKEIRFGNSGLTAEQWSLVDSAKVVIFVSFNARESPYQMALGRELSSRARSLV
TIAGCAPYDFLEALEMTTYITTYEPTIEAFTQATKIMFGLATANGALPIGQAKAHSSIAV
TPFDASRDIDELAAVWKTALPTYPLPASSLRCFLDRANGHHSVARVGSTMVGFCVAYTNT
NQEKISGRIAVLAVDPGHQGRGVGTALLNETRAHFRNKFQLNTLELTSNFPRFWPGIPRE
LPSQVQDFFIHRGFRLNPPGARSVDLYQDIRNFQPPEKYISRAKERGYIFSPLLPEHYDN
CVVAQKRNFSASLGWVEAYIELNPSEYPSNVMVAFDSEGRQVGWTLMLPPSSSFLQRLWA
FPPLCGPQTGLIGCVGVDKECRKAGVGLALLCHAMMDMKSRGIEGVFVDWVSLDGWYEQL
GFKVWRSYRPGEI

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	292	1.5e-57	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.39e-92	6	415	3	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.31e-82	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.46e-43	36	294	26	281	beta-hexosaminidase; Provisional
185053	PRK15098	1.05e-10	6	396	47	423	beta-glucosidase BglX.
404402	Acetyltransf_7	2.54e-07	578	675	2	82	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85716.1|GH3	0.0	1	853	1	854
CAP94355.1|GH3	0.0	5	853	5	852
QQK41162.1|GH3	0.0	1	853	1	852
BCR93582.1|GH3	0.0	6	853	6	857
BCS06215.1|GH3	0.0	6	853	6	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	6.98e-155	3	853	6	858	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	4.25e-95	6	528	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.24e-62	26	331	76	393	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	9.69e-62	26	331	50	367	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.75e-61	26	331	80	397	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.67e-61	26	331	76	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.55e-56	22	390	50	435	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	2.85e-37	7	331	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	7.09e-37	7	331	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|Q9K0Q4|NAGZ_NEIMB	2.50e-36	26	298	23	294	Beta-hexosaminidase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_57113-t33_1-p1.