CAZyme Information: ASPZODRAFT_55299-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_55299-t33_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	KV878336|CGC25	44535.70	5.1460

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878336:3244815-3246005(-)

Full Sequence      

MQSPGSPWGVGTTRLPRQVRKILPACVVFFMLTLYLSITGLFGEFGGAGSGFPSRPSSGT
GHLFPRKIWQTWKVDPLEFDERDLATARSWTAKNPGHRYEVLTDQNDLYYVETYFGPDGF
NRPDIVAMYRALTAKIIKADLLRYLVMYVEGGVYTDIDVEALKPIQRFIPERFDERDINM
IIGVEIDEPALKDHAILGPKSQSFCQWTFVCKPGLPVMMTLVDHILLWLNEVSRRQGKPV
AEIELDFDEVISGTGPSAFTNAVLEYMSQREGRSITWDTFHNMAESKLVGGVLVLTVEAF
AAGQGHSDSGNHNARTALVKHHYHASGWPTNHPRYSHPLYGEVEQCNWNKECVAEWDANI
AAFDALPLEEQAKQLAIKQAMDVPEMDDTIPIPIDF

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_55299-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	85	170	4.3e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.33e-25	64	290	82	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.77e-12	80	171	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96510.1|GT32	2.50e-197	15	387	24	390
BCS17076.1|GT32	1.26e-196	15	387	30	396
QMW28814.1|GT32	8.84e-196	15	389	6	379
QRD83354.1|GT32	1.02e-195	15	389	10	383
QMW40889.1|GT32	1.78e-195	15	389	6	379

PDB Hits     

ASPZODRAFT_55299-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.00e-37	65	328	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.46e-32	64	321	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.21e-31	64	300	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	9.62e-22	65	321	97	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.45e-06	65	159	58	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000002

TMHMM  Annotations     

Start	End
21	43