CAZyme Information: ASPZODRAFT_29260-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_29260-t33_1-p1
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		54051.32	3.9541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878360:151530-153107(+)

Full Sequence      

MQAILKAPASMSSTVSLTVPATATNAVLAPGDFVGFGFETAFVNDYANDFSNKLMNSVAK
RLPETLTIRTGGTSGDMLTYDPGQAAVKVCVSGDCPIGSSAAYILGPAYFDGFASFQDFH
LSVQAPLGPTVNLSNTLAYVELALDQVGDRLAAIAIGNEPNLYPAEFGVSYSIEQYVADV
ELVRANLTDALGLNETIFELLDISDFAETDSTTKFTIINTFERGIDSTDNAKFAATHFYQ
IKTETSTLAQMQTDLMNHAVIVSNISAGVPQDVAYLAANYPAVQYIFSETGSGLTTPREI
QDSFGAALWFVDFQLYSLVSGVARVDGTQRPAANHSLWVPDDSAGDVNPGPQVRAPFYAQ
PFVADFIGLAPGNVLEIDLASDYLVAYASYNASTGAAEKLALINFIAWADGISTASRGSV
SFAVSASGLRDTVRVRRLRAEAGCQAMGYDYAGPEQNITWAGEQWSYSLDGGEGHLVANV
NVSEVVDVTDGQFTVQVLDSEAILVDLI

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_29260-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	32	413	8e-32	0.8373626373626374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	2.44e-16	386	504	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23789.1|GH79	5.64e-78	16	504	26	539
SMR55723.1|GH79	1.21e-44	3	508	12	503
SMQ52897.1|GH79	2.97e-44	3	508	8	499
AQA29326.1|GH79	7.44e-44	54	507	76	515
UJO16671.1|GH79	7.44e-44	54	507	76	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	7.29e-13	68	507	60	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	2.88e-27	10	507	32	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	5.62e-20	33	480	37	521	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999882	0.000174

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_29260-t33_1-p1.