CAZyme Information: ASPZODRAFT_25867-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_25867-t33_1-p1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1173	KV878342|CGC2	128767.46	6.4357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878342:1199728-1203687(-)

Full Sequence      

MVCDQYYLPDMSDTYDYIIVGGGLSGCVLAARLASAHPSRSILLLEAGSDVRNNRLTGSP
LACFGAHHSPLDWAYTTVPQAHLDGRACYNSAGKALGGGTATNYGTWTRGNAADYDLWAE
IVQDESWNYQNLLPYFQRSETHWDPAADTAVHGRSGPIHNATVSSSSSERRYPLRDPLEA
AWNRLDVQTIVDGNAGHPLGLAELTENWRDGHRQLASEAYGVREKPNLSVRTETMVEKVL
LAEDDGQKGRKIATGVQLADGRATRFSARREVILCAGAYRTPQLLMLSGIGPAEELAKHG
IPLQVDAPHVGRNFHDHFSFNQWWKLRHPEKGLSVGTPQWNEIPAYGLGLPASWVATVQT
PREQLEQALKLDGIAVGDGLAQHPYLAPDFCHVETLVVYAPAGAAVAGLAEEVPMDGSYI
ASAVLGVTPTSRGTITLSSADVTVPPLIDPNYYATEVDRVSLRAGIRQVTRLLCDTPEGK
EMVVEQVARPGLRPLTSHSTDEEIDRHVKQGGATFYHPAGSAAMGKVVDTQLRVSGVQGL
RVVDASVLPLSLAAHYQAILNSRHHERKENLLASSRGRRSAIAQFYLSNSTAPQRETGMV
YCGRPSASCALCRAKKRRCDKATPACGQCRRTNQKCPGYRDTSKLVFRDETTRVIGRVQT
LQANKRALEGSTALSGQDRSPSLASSDRDKSSASQDEQDCSEDSVNVFGAFDTLDTLDTL
DTLDLDNDFNTIDVLLSSPPAPSESLGDLGVNYFLTNYVVLDSGPCPGYLNYTWDMLVDP
DGNTELVQVVVSAAGLAGLAGTTGSASIMTKARASYTRAIEQVNAALRNSVMTGDDSTVF
AVMVLGLFETITCTDNNSLQAWGQHINGAANLLMHRGTAQFRTKQGLQIFGEAVSHVLTL
CSRTGLPVPPRLRFLRMEMERKMARKSPSWVLSTAHIEAMDLWHRVDPELETPFLPAEWE
MLLSHAVELDRRLETVVADMPDSWRFKTIHDPGADPRIAYHGTYHVYYNPWVAKVWNGLR
SCRILLHQVTYCLLQRECRVWAPHELDPVPGGAYVGLLRRAAQITIEMRDGILASVPQMM
GFVDDRGSITRQADPYFHLHASAPASGAYFLVWFLFLAGYLPINPPEIRAWTIDRLRAIR
SATGIQKATFLGRIIEFDPNFAPDDDRFLIPDF

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_25867-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	559	3.9e-146	0.9700704225352113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.77e-102	11	549	2	509	choline dehydrogenase; Validated
225186	BetA	3.85e-82	10	558	3	520	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.72e-65	16	549	2	464	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
215420	PLN02785	3.29e-37	3	558	44	563	Protein HOTHEAD
398739	GMC_oxred_C	7.29e-34	429	558	1	134	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58856.1|AA3_2	8.11e-242	15	560	6	542
BCS24407.1|AA3_2	7.57e-236	8	560	1	548
CAK40717.1|AA3_2	1.39e-233	11	560	1	540
BCS16263.1|AA3_2	2.48e-231	11	560	1	540
BCS04695.1|AA3_2	2.48e-231	11	560	1	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.04e-60	14	560	5	553	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	8.38e-58	15	557	2	547	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.55e-58	15	557	3	548	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	6.37e-56	8	557	35	583	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	7.27e-56	15	550	7	548	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	1.32e-126	11	573	1	520	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.34e-66	12	576	4	537	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	2.87e-63	11	558	1	513	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	2.87e-63	11	558	1	513	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P64264|Y1310_MYCBO	2.87e-63	11	558	1	513	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000018

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_25867-t33_1-p1.