CAZyme Information: ASPZODRAFT_2127732-t33_1-p1

Basic Information

• Species: Penicilliopsis zonata
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicilliopsis; Penicilliopsis zonata
• CAZyme ID: ASPZODRAFT_2127732-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		30005.42	4.3640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PzonataCBS506.65	10027	1073090	158	9869

• Gene Location: location=KV878341:301542-302579(+)

Full Sequence      

MEQTTYLFTFGDSYTQTDFDPSGTKPSLSNPMGNPKLGTCTSSGGINWVGYLVTSNPGIL
SFNLAAGGATIDKAMIHSDARDLVSQINLFGEHYCPRDGGKAVPWTSENAVFGIWIGINE
YEPTVYSNDLYFNDSVGLSFEGKTPPIQSLMNRYAAQMERLYDEGARRFLFLNVPPTSRS
PLIGLQGSQVENRHAEWVKAFNDALGQMVRAVLYDTWSFMTAILDDPEKYGFENSEDGAE
QIWWNDYHPSSRYHRLQVEDMGDVINMI

Enzyme Prediction     

No EC number prediction in ASPZODRAFT_2127732-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	7	261	2.6e-72	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.50e-48	6	256	1	262	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	2.15e-20	63	250	79	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	5.24e-12	10	256	35	324	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	3.58e-09	7	256	4	272	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	1.12e-08	7	259	1	222	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ULM60884.1|CE16	1.23e-83	5	261	26	283
BCS24928.1|CE16	9.91e-83	5	265	28	288
BCR94351.1|CE16	6.82e-82	5	265	43	304
QRD88580.1|CE16	1.06e-81	5	265	30	307
BCR91967.1|CE16	1.34e-81	3	261	55	333

PDB Hits     

ASPZODRAFT_2127732-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	4.56e-49	4	263	31	295	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	6.43e-49	4	263	31	295	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999823	0.000226

TMHMM  Annotations     

There is no transmembrane helices in ASPZODRAFT_2127732-t33_1-p1.